Lus10006459 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G50260 307 / 4e-105 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT3G48340 290 / 3e-98 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT3G48350 282 / 4e-95 CEP3 cysteine endopeptidase 3, Cysteine proteinases superfamily protein (.1)
AT5G45890 261 / 4e-87 SAG12 senescence-associated gene 12 (.1)
AT5G43060 256 / 1e-83 Granulin repeat cysteine protease family protein (.1)
AT4G36880 250 / 2e-82 CP1 cysteine proteinase1 (.1)
AT3G19390 250 / 1e-81 Granulin repeat cysteine protease family protein (.1)
AT3G49340 244 / 1e-80 Cysteine proteinases superfamily protein (.1)
AT4G35350 244 / 2e-80 XCP1 xylem cysteine peptidase 1 (.1.2)
AT4G11310 243 / 9e-80 RD21A, RD21 Papain family cysteine protease (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018083 305 / 5e-104 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10033040 301 / 1e-102 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10042078 301 / 1e-102 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10013674 299 / 6e-102 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10042691 270 / 3e-92 AT5G50260 321 / 5e-110 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10029658 273 / 5e-92 AT5G45890 383 / 4e-133 senescence-associated gene 12 (.1)
Lus10042693 271 / 3e-91 AT5G45890 379 / 1e-131 senescence-associated gene 12 (.1)
Lus10029649 269 / 2e-90 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Lus10002301 269 / 3e-90 AT5G45890 397 / 1e-138 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G183100 348 / 2e-121 AT5G50260 489 / 2e-174 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.015G087400 315 / 2e-108 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.012G090900 313 / 2e-107 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.015G087500 294 / 5e-100 AT5G50260 530 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.013G118200 283 / 2e-96 AT5G45890 387 / 2e-135 senescence-associated gene 12 (.1)
Potri.013G126100 282 / 2e-95 AT5G45890 386 / 2e-134 senescence-associated gene 12 (.1)
Potri.013G118400 276 / 2e-93 AT5G45890 378 / 2e-131 senescence-associated gene 12 (.1)
Potri.011G064900 272 / 1e-91 AT5G45890 401 / 3e-140 senescence-associated gene 12 (.1)
Potri.004G056100 272 / 2e-91 AT5G45890 419 / 2e-147 senescence-associated gene 12 (.1)
Potri.004G056258 269 / 2e-90 AT5G45890 417 / 8e-147 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10006459 pacid=23171975 polypeptide=Lus10006459 locus=Lus10006459.g ID=Lus10006459.BGIv1.0 annot-version=v1.0
ATGGAGAGAATCGGAAGCTGCTGGGCATTTTCCACCGTGGCCGCCGTGGAAGGCATCAACAAGATCAGAACAGGGGAGCTAGTGTCTTTATCGGAGCAGG
AGCTTGTAGATTGCAGCAAGGACAACAATGGCTGCGATGGAGGTCTAATGGAGCAAGCTTTCAAGTTCATAGAGCAAGTCGGCGGGCTAACCACGGAGAC
CAACTATCCTTACGAAGCTAGAGATGAATCCTGCAACTCAGCCAAGTTGAATGTGGCCGCAGTTCAGATCGATGGGTACGAGAATGTGCCGGAGAACGAC
GAGAACGCGCTGATGAAGGCTGCTGCTAACCAGCCGGTGGCGATCTCCATTGATGCTGGTGGCAGAGATCTCCAATTCTACTCTGAGGGAGTGTTCAACG
GGCAATGCGGGACAGAGCTGAACCATGGGGTGGCACTCGTGGGGTACGGGTCGACTCAAGATGGCACGAAGTACTGGATCGTAAAGAACTCGTGGGGGAC
GGAGTGGGGGGAGCAAGGCTACATAAGAATGCAGCGTGGGATCGATGCTGAAGAAGGTATATGTGGCATAGCTATGGATGCTTGTTACCCTGTGAAGGCC
ACCACTCCACCCAGCTTTATCAAGAATACAACTGCCTCAAAGAAGGATGAACTGTAA
AA sequence
>Lus10006459 pacid=23171975 polypeptide=Lus10006459 locus=Lus10006459.g ID=Lus10006459.BGIv1.0 annot-version=v1.0
MERIGSCWAFSTVAAVEGINKIRTGELVSLSEQELVDCSKDNNGCDGGLMEQAFKFIEQVGGLTTETNYPYEARDESCNSAKLNVAAVQIDGYENVPEND
ENALMKAAANQPVAISIDAGGRDLQFYSEGVFNGQCGTELNHGVALVGYGSTQDGTKYWIVKNSWGTEWGEQGYIRMQRGIDAEEGICGIAMDACYPVKA
TTPPSFIKNTTASKKDEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10006459 0 1

Lus10006459 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.