Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26360 105 / 1e-30 Ribosomal protein S21 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011406 [exp] 182 / 2e-54 AT3G26350 209 / 5e-60 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G048600 [exp] 89 / 5e-24 AT3G26360 106 / 3e-31 Ribosomal protein S21 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01165 [flax] [poplar] Ribosomal_S21 Ribosomal protein S21
Representative CDS sequence Show only first row Show all	>Lus10006466 pacid=23171969 polypeptide=Lus10006466 locus=Lus10006466.g ID=Lus10006466.BGIv1.0 annot-version=v1.0 ATGAACTGGATAACGAAGAAAACAAAACTCGCCTCCGCCGCCGCGGCGGTTGGGGAGAGGCAGATTTTATGCCGGACGCAGCAATCGCGGGGGATCCGAG TGAAGGTGTACGACGGGAACGTAGAGAGGGCATTGACTGTTCTACAGAGGAAGATGCAGTCGAGCGGGATGGAGCGACTGATCAAGAAGACGCAGAGGAC TCACCTGAAGAACTCCGAGAAGCGAGTTCTAGCTCACAAGAACCTGCTTCACCGGGTTAAGGCTGAGGATCTGGCGCGGAAGCTCCAGGACATCCTCCAC AAGAAGATCAGGTCACACTTTTTGGATGTTTGTTTTCGATTCGCTTAG
AA sequence Show only first row Show all	>Lus10006466 pacid=23171969 polypeptide=Lus10006466 locus=Lus10006466.g ID=Lus10006466.BGIv1.0 annot-version=v1.0 MNWITKKTKLASAAAAVGERQILCRTQQSRGIRVKVYDGNVERALTVLQRKMQSSGMERLIKKTQRTHLKNSEKRVLAHKNLLHRVKAEDLARKLQDILH KKIRSHFLDVCFRFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26360			Ribosomal protein S21 family p...		Lus10006466 [exp]	0	1
AT1G31817		NFD3	NUCLEAR FUSION DEFECTIVE 3, Ri...		Lus10012155 [exp]	1.4	0.8575
AT3G53740			Ribosomal protein L36e family ...		Lus10040766 [exp]	4.2	0.7529
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	4.9	0.7687
AT4G16450			unknown protein		Lus10038803 [exp]	5.8	0.7724
AT5G11340			Acyl-CoA N-acyltransferases (N...		Lus10008088 [exp]	6.7	0.7593
AT2G35605			SWIB/MDM2 domain superfamily p...		Lus10033312 [exp]	7.9	0.7271
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Lus10015840 [exp]	9.5	0.7072
AT5G41685			Mitochondrial outer membrane t...		Lus10016473 [exp]	9.8	0.7340
AT2G41600			Mitochondrial glycoprotein fam...		Lus10042042 [exp]	11.8	0.6955
AT1G36390			Co-chaperone GrpE family prote...		Lus10024760 [exp]	12.4	0.7722

Compare expression of checked genes

Lus10006466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.