Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41720 48 / 6e-08 unknown protein AT1G64295 43 / 4e-06 F-box associated ubiquitination effector family protein (.1) AT2G05360 43 / 6e-06 unknown protein AT1G64290 40 / 4e-05 F-box protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011415 [exp] 87 / 3e-22 AT5G41720 52 / 1e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G214000 [exp] 53 / 1e-09 AT1G64295 140 / 3e-38 F-box associated ubiquitination effector family protein (.1) Potri.010G224400 [exp] 49 / 3e-08 AT1G64295 161 / 1e-45 F-box associated ubiquitination effector family protein (.1) Potri.006G167500 [exp] 49 / 5e-08 AT1G64290 118 / 2e-30 F-box protein-related (.1) Potri.014G187100 [exp] 48 / 6e-08 AT1G64295 132 / 2e-35 F-box associated ubiquitination effector family protein (.1) Potri.007G037500 [exp] 47 / 1e-07 AT1G64295 130 / 9e-35 F-box associated ubiquitination effector family protein (.1) Potri.017G066400 [exp] 47 / 2e-07 AT1G64295 125 / 9e-33 F-box associated ubiquitination effector family protein (.1) Potri.008G038000 [exp] 44 / 2e-06 AT1G64290 175 / 3e-51 F-box protein-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10006473 pacid=23171954 polypeptide=Lus10006473 locus=Lus10006473.g ID=Lus10006473.BGIv1.0 annot-version=v1.0 ATGGCGGCGCCGACAGAAAACCAAAGCCAAAACCTTTCCTCCTCCACCGCAGAATTGCCATTCGACGTCGTCTCAGAGATCCTCACGTTCTGCTCGTCAC CCACAGTCGCCAAGTTCCGAGCCACCTCCCGCGGTCTCAACTCCCACACCTACGAGTCCAACTTCCGGCGACTCCACTTCCATCGCACCGCCGCCGTCTC CGGCTTCCTCTGCCAGCGCCTCCGCTCCACCCTCTTCCGGCTTCTCCACAACATTCGTTCCTAA
AA sequence Show only first row Show all	>Lus10006473 pacid=23171954 polypeptide=Lus10006473 locus=Lus10006473.g ID=Lus10006473.BGIv1.0 annot-version=v1.0 MAAPTENQSQNLSSSTAELPFDVVSEILTFCSSPTVAKFRATSRGLNSHTYESNFRRLHFHRTAAVSGFLCQRLRSTLFRLLHNIRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41720			unknown protein		Lus10006473 [exp]	0	1
AT5G55690	MADS		MADS-box transcription factor ...		Lus10014095 [exp]	2.2	0.8976
					Lus10036058 [exp]	2.4	0.8878
					Lus10020461 [exp]	3.2	0.8890
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023037 [exp]	3.7	0.8389
AT5G65750			2-oxoglutarate dehydrogenase, ...		Lus10029463 [exp]	4.5	0.7783
AT2G04865			Aminotransferase-like, plant m...		Lus10003728 [exp]	4.9	0.8642
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Lus10035663 [exp]	4.9	0.8584
AT2G39380		ATEXO70H2	exocyst subunit exo70 family p...		Lus10005435 [exp]	5.0	0.8631
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Lus10017825 [exp]	6.0	0.8123
AT5G04010			F-box family protein (.1)		Lus10031031 [exp]	6.2	0.7967

Compare expression of checked genes

Lus10006473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.