Lus10006480 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47420 131 / 1e-38 SDH5 succinate dehydrogenase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009768 246 / 3e-84 AT1G47420 227 / 3e-75 succinate dehydrogenase 5 (.1)
Lus10042661 227 / 2e-76 AT1G47420 268 / 9e-91 succinate dehydrogenase 5 (.1)
Lus10021742 227 / 3e-76 AT1G47420 270 / 1e-91 succinate dehydrogenase 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G032400 164 / 1e-51 AT1G47420 281 / 6e-96 succinate dehydrogenase 5 (.1)
PFAM info
Representative CDS sequence
>Lus10006480 pacid=23142517 polypeptide=Lus10006480 locus=Lus10006480.g ID=Lus10006480.BGIv1.0 annot-version=v1.0
ATGAATAAGATGTTGGCGCTGAGGTCTGTATGTCGAGCGGCTTCTCTTAGATCTTCGTTGAACTTGCCCGCTATCATCACCAACCATCTTTTACACCATC
ACACGCCTCCCCGATCCCTGTTCACCCTTTCTTCCGCTGCCAATCGGCTCCCTTCCGGCTCCCTGGCTGCATTTACAAGTTGCATCGGTAGAACAAGAGC
GTTTAGTGTGGATGTAGCACACTTGCCTGAGGTCAAAGACCCTGATGTCTTATGTGCCTTCAAGGACTTGATGGCTGCAAGCTGGGATGAACTCGATGTG
ACTGCTGTCCATGATGTTAAAAATGCATTGTCCAAGAGCTCCGATGACAAGCCTGGTCAAGAAGTCTTGAAGAATGTTTTCCGAGCATCTCAAGCTGTGG
AGGAATTCGGTGGGATGATCATGGCTTTAAAGATGGAGCTAGATGACAGTATTGGGATTGAGTGGTGA
AA sequence
>Lus10006480 pacid=23142517 polypeptide=Lus10006480 locus=Lus10006480.g ID=Lus10006480.BGIv1.0 annot-version=v1.0
MNKMLALRSVCRAASLRSSLNLPAIITNHLLHHHTPPRSLFTLSSAANRLPSGSLAAFTSCIGRTRAFSVDVAHLPEVKDPDVLCAFKDLMAASWDELDV
TAVHDVKNALSKSSDDKPGQEVLKNVFRASQAVEEFGGMIMALKMELDDSIGIEW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47420 SDH5 succinate dehydrogenase 5 (.1) Lus10006480 0 1
AT2G32280 Protein of unknown function (D... Lus10038567 64.9 0.6624
AT3G06580 GAL1, GALK GALACTOSE KINASE 1, Mevalonate... Lus10037789 89.9 0.6607
AT1G68140 Protein of unknown function (D... Lus10025356 92.1 0.6712
AT1G54070 Dormancy/auxin associated fami... Lus10013180 153.9 0.6403
AT1G12820 IPS1, AFB3 auxin signaling F-box 3 (.1) Lus10006738 181.0 0.6506
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10012399 241.1 0.6360

Lus10006480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.