Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37470 64 / 4e-14 Histone superfamily protein (.1) AT5G02570 64 / 5e-14 Histone superfamily protein (.1) AT3G53650 64 / 5e-14 Histone superfamily protein (.1) AT1G07790 64 / 5e-14 HTB1 Histone superfamily protein (.1) AT2G28720 64 / 1e-13 Histone superfamily protein (.1) AT5G59910 63 / 1e-13 HTB4 Histone superfamily protein (.1) AT3G45980 62 / 3e-13 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 62 / 4e-13 HTB11 Histone superfamily protein (.1) AT5G22880 61 / 2e-12 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G09480 58 / 1e-11 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040850 [exp] 63 / 3e-14 AT5G02570 137 / 1e-43 Histone superfamily protein (.1) Lus10017456 [exp] 64 / 6e-14 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10005897 [exp] 64 / 1e-13 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10040855 [exp] 63 / 2e-13 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10005893 [exp] 63 / 2e-13 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10023753 [exp] 62 / 3e-13 AT2G37470 203 / 7e-69 Histone superfamily protein (.1) Lus10013544 [exp] 62 / 4e-13 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10037371 [exp] 62 / 4e-13 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10016156 [exp] 62 / 5e-13 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G123700 [exp] 65 / 4e-14 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091400 [exp] 64 / 6e-14 AT2G28720 186 / 1e-61 Histone superfamily protein (.1) Potri.009G028001 [exp] 64 / 7e-14 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.004G091200 [exp] 64 / 7e-14 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.010G230701 [exp] 64 / 8e-14 AT5G59910 191 / 3e-63 Histone superfamily protein (.1) Potri.008G030600 [exp] 64 / 8e-14 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.008G029900 [exp] 64 / 9e-14 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.010G231300 [exp] 64 / 9e-14 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.010G230801 [exp] 63 / 1e-13 AT1G07790 205 / 2e-69 Histone superfamily protein (.1) Potri.010G230600 [exp] 63 / 1e-13 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006484 pacid=23142511 polypeptide=Lus10006484 locus=Lus10006484.g ID=Lus10006484.BGIv1.0 annot-version=v1.0 ATGGCGGAGGTGAATCTCGAGGCAAACGAAAAGCAGGAGACCGTTGACAGGATCAAAGGTCTGTTTGGGACGAAAAAGTGGAAAGGAAAAGGGAGGAGAG AGTTAGAGCGATTGGTTGTTACAGGAAATGGAGACGAATCTGGAGAAGGTCCTCCGTCCATCCGAGATGACACCAAAGGCGGAGTACTTTACAATTACAT GAACTTCTTCATCAATGACATTCTTAAGAAGCTCACACAGAAGTCTCCAAGCTGGCCCTTTACATTCAACAAGAAGCCAATGATCACCTCCAGACAAATC CAGACTGTCGCCCAATTGGTGCTCCCCGGTGAACTCACCAACCACACAACACATGAGTGTATTGTATCTGAATTCTGA
AA sequence Show only first row Show all	>Lus10006484 pacid=23142511 polypeptide=Lus10006484 locus=Lus10006484.g ID=Lus10006484.BGIv1.0 annot-version=v1.0 MAEVNLEANEKQETVDRIKGLFGTKKWKGKGRRELERLVVTGNGDESGEGPPSIRDDTKGGVLYNYMNFFINDILKKLTQKSPSWPFTFNKKPMITSRQI QTVAQLVLPGELTNHTTHECIVSEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37470			Histone superfamily protein (....		Lus10006484 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10035423 [exp]	2.2	0.7385
AT1G71820		SEC6	SEC6 (.1.2)		Lus10036425 [exp]	3.5	0.7038
AT3G04690		ANX1	ANXUR1, Malectin/receptor-like...		Lus10016907 [exp]	7.5	0.7153
AT1G22710		SUT1, ATSUC2, S...	SUCROSE TRANSPORTER 1, ARABIDO...		Lus10022633 [exp]	7.7	0.6846
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10004274 [exp]	7.9	0.7024
					Lus10005948 [exp]	9.0	0.7234
AT3G10330			Cyclin-like family protein (.1...		Lus10031056 [exp]	10.1	0.6720
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Lus10018704 [exp]	10.7	0.7096
AT5G14000	NAC	ANAC084	NAC domain containing protein ...		Lus10032004 [exp]	11.5	0.6843
					Lus10020961 [exp]	11.7	0.7014

Compare expression of checked genes

Lus10006484 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.