Lus10006487 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33350 326 / 5e-113 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
AT3G23710 143 / 9e-41 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009759 463 / 2e-166 AT4G33350 355 / 3e-124 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10022378 152 / 2e-44 AT3G23710 305 / 2e-103 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10007784 137 / 7e-39 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G030000 364 / 8e-128 AT4G33350 359 / 5e-126 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G126800 364 / 9e-128 AT4G33350 374 / 7e-132 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G236000 153 / 1e-44 AT3G23710 351 / 7e-122 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Lus10006487 pacid=23142507 polypeptide=Lus10006487 locus=Lus10006487.g ID=Lus10006487.BGIv1.0 annot-version=v1.0
ATGGAGCCCTATAAACCCTCAAACCCTCTCTTATCCTTCTCCTCCTTTCTCCACCAACAATGTCTCCGCATAGGCTCCGATTTCTCCACTCGCCTCGGCG
ACACCACTCGAGCCCTATCCACCTCCTTCCCCGCAGCAAGGGCCAGGAGGCTCAACCTTCCACCGCCGCCGCTATTCGCCTCAGTTTCTGAGGCGAAACC
GTCATCGCCAAGGCTCAGCTCCGATTACGTGGCTAAGAGACTCACTGGCACGACCGTCTACACGGTGAGCAACACCAACAACGAGTTCGTCCTCATTTCT
GATCCTGATGGAGCTAAGTCCATTGGATTGCTCTGCTTCCGCAAAGAAGATGCTGAAGCTTTTCTGTATCAGGTGCGATTGCGAAGAAATGAATTACGAA
GTGCGGCGAAGGTAGTGCCTATTACTCTTGAGCAGGTCTACATGCTGAAGGTTGAAGGCATTTCATTCAGGTTCTTGCCAGATCCTGTCCAAATAAAGAA
CGCATTGGAGATGAAAACTTCCAGCACAAGCAGCGGGTTCGATGGAGTTCCTGTTTTCCAGTCAGAACTTCTGGCAGTGAAGAAGAAAAACAGGCGTTTC
TGCCCTATATACTTCCAAAAGGTATTTGGACTTGCTGAGGACATAGATAAAGAATTGACCAAGGTTTCAAGAGGGAGAGCCATTTCTCCTAATATAATGG
TGGGGAGCTTGGAAGATGTTGTGAGAAAAATTGAGACGAGTGAGAAAAACTCGGGTTGGGAAGATTTGATATTCATTCCACCTGGTAAAACACAGTCCGA
ACACATTAATGACATAACCAAGTGA
AA sequence
>Lus10006487 pacid=23142507 polypeptide=Lus10006487 locus=Lus10006487.g ID=Lus10006487.BGIv1.0 annot-version=v1.0
MEPYKPSNPLLSFSSFLHQQCLRIGSDFSTRLGDTTRALSTSFPAARARRLNLPPPPLFASVSEAKPSSPRLSSDYVAKRLTGTTVYTVSNTNNEFVLIS
DPDGAKSIGLLCFRKEDAEAFLYQVRLRRNELRSAAKVVPITLEQVYMLKVEGISFRFLPDPVQIKNALEMKTSSTSSGFDGVPVFQSELLAVKKKNRRF
CPIYFQKVFGLAEDIDKELTKVSRGRAISPNIMVGSLEDVVRKIETSEKNSGWEDLIFIPPGKTQSEHINDITK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33350 AtTic22-IV translocon at the inner envelo... Lus10006487 0 1
AT2G47640 Small nuclear ribonucleoprotei... Lus10026556 4.0 0.9088
AT1G75330 OTC ornithine carbamoyltransferase... Lus10010641 9.6 0.9154
AT2G34060 Peroxidase superfamily protein... Lus10005278 13.0 0.8982
AT5G45590 Ribosomal protein L35 (.1) Lus10012140 17.3 0.9023
AT2G15480 UGT73B5 UDP-glucosyl transferase 73B5 ... Lus10014080 20.5 0.8709
AT5G04430 BTR1S, BTR1L, B... BINDING TO TOMV RNA 1S \(SHORT... Lus10037932 21.7 0.9082
AT4G21090 ATMFDX2 ARABIDOPSIS MITOCHONDRIAL FER... Lus10014947 28.6 0.8561
AT4G26500 SUFE1, EMB1374,... SULFUR E 1, MBRYO DEFECTIVE 13... Lus10026101 31.4 0.8846
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Lus10034105 31.6 0.8407
AT5G24330 SDG34, ATXR6 SET DOMAIN PROTEIN 34, ARABIDO... Lus10007782 33.6 0.8933

Lus10006487 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.