Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15910 73 / 2e-18 ATDI21 drought-induced 21 (.1) AT4G02380 64 / 7e-15 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT1G02820 59 / 4e-13 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT3G53770 48 / 2e-08 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037497 [exp] 155 / 8e-51 AT4G15910 73 / 5e-18 drought-induced 21 (.1) Lus10027986 [exp] 56 / 8e-12 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 56 / 1e-11 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10008169 [exp] 46 / 5e-08 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10027987 [exp] 46 / 8e-08 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G012100 [exp] 77 / 9e-20 AT4G15910 83 / 6e-22 drought-induced 21 (.1) Potri.002G203500 [exp] 56 / 2e-11 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 54 / 8e-11 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10006508 pacid=23141652 polypeptide=Lus10006508 locus=Lus10006508.g ID=Lus10006508.BGIv1.0 annot-version=v1.0 ATGGCTGGCTCCGTCGCTACCTCTAAGCTTCTTCCAGCTTCCGTCTCCATTTTCTGGAGAGGTTATGCTGCGACGGCGGGTCCGTTAGGTGCTGTTGTTG GTAGAGGAGGGCCGGCCGGCAAGGTGCTGAAGGAGGAGAAATCGGCGGCAAACAATGGTTCAGAGTCTGCTTGGGCTCCCGACCCGGTGACCGGGTACTA TAGGCCCGGAAACTCTCCTGACGAGATCGACCCAGTAGAGCTCCGAGAAATGTTGCTGAACAACAGAGTCAAGTCCAATTAG
AA sequence Show only first row Show all	>Lus10006508 pacid=23141652 polypeptide=Lus10006508 locus=Lus10006508.g ID=Lus10006508.BGIv1.0 annot-version=v1.0 MAGSVATSKLLPASVSIFWRGYAATAGPLGAVVGRGGPAGKVLKEEKSAANNGSESAWAPDPVTGYYRPGNSPDEIDPVELREMLLNNRVKSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15910		ATDI21	drought-induced 21 (.1)		Lus10006508 [exp]	0	1
AT1G66540			Cytochrome P450 superfamily pr...		Lus10032856 [exp]	4.1	0.9032
AT3G60540			Preprotein translocase Sec, Se...		Lus10037570 [exp]	12.1	0.8840
AT3G22560			Acyl-CoA N-acyltransferases (N...		Lus10021914 [exp]	13.0	0.8906
AT4G33740			unknown protein		Lus10020507 [exp]	15.1	0.8941
AT1G26665			Mediator complex, subunit Med1...		Lus10024211 [exp]	19.9	0.8760
AT2G14210	MADS	AGL44, ANR1	ARABIDOPSIS NITRATE REGULATED ...		Lus10028214 [exp]	20.5	0.8891
AT1G63380			NAD(P)-binding Rossmann-fold s...		Lus10007038 [exp]	21.6	0.8923
AT1G29280	WRKY	ATWRKY65, WRKY6...	WRKY DNA-binding protein 65 (....		Lus10029252 [exp]	29.7	0.8865
AT5G03345			unknown protein		Lus10013817 [exp]	33.9	0.8471
AT5G46840			RNA-binding (RRM/RBD/RNP motif...		Lus10004563 [exp]	34.0	0.8706

Compare expression of checked genes

Lus10006508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.