Lus10006512 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50650 71 / 4e-16 Stigma-specific Stig1 family protein (.1)
AT4G26880 65 / 5e-14 Stigma-specific Stig1 family protein (.1)
AT1G11925 64 / 1e-13 Stigma-specific Stig1 family protein (.1)
AT1G53130 61 / 2e-12 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT5G55110 60 / 7e-12 Stigma-specific Stig1 family protein (.1)
AT1G50720 57 / 4e-11 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041930 70 / 6e-16 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10005544 66 / 1e-14 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10020831 62 / 7e-13 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10012679 60 / 6e-12 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Lus10011146 60 / 8e-12 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10043047 59 / 1e-11 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10000696 57 / 2e-10 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10011117 56 / 3e-10 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G220900 132 / 2e-40 AT1G11925 73 / 3e-17 Stigma-specific Stig1 family protein (.1)
Potri.001G399200 72 / 9e-17 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Potri.011G118600 70 / 5e-16 AT1G53130 136 / 1e-41 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Potri.001G356600 66 / 4e-14 AT1G50720 133 / 2e-40 Stigma-specific Stig1 family protein (.1)
Potri.010G228100 65 / 6e-14 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1)
Potri.004G006900 64 / 9e-14 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.011G009100 64 / 2e-13 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Potri.011G080800 63 / 2e-13 AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
Potri.004G007000 62 / 8e-13 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G009000 62 / 9e-13 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10006512 pacid=23141629 polypeptide=Lus10006512 locus=Lus10006512.g ID=Lus10006512.BGIv1.0 annot-version=v1.0
ATGCTCTCACCCGCACTACTTGTCATCACCATCCTCCTCTTCCTCTCCGCTGCCAGCTGGCCAAGCCATGCCGGTGACGACGGCGGCCGTCCAAGCCACT
TGAACTTCTTCCGGTCGAGCTCTCGCAGGCCACGCCAGGGGTACTGGTGCAGCAGAGACGATCCTGAGGCGTGTTTGAGGAACCCACGGGGAGGGCGGAC
TTGCTGTTTCGGGAGAGTTTGTAAGGACACGCTTAGAGACGGCAATAACTGCGGGACGTGTGGGGAAAAGTGTCCGTTTGGGTTCGTTTGCTGCGATGGA
AAGTGTGTGGATGTTAGGAATGATGCTAGCCATTGCGGATCGTGCTTTCAGGAGTGCCGTTCTGGTCAACGGCTCTGCTCTTTTGGAATGTGTGATTATG
CCGCTGCCTGA
AA sequence
>Lus10006512 pacid=23141629 polypeptide=Lus10006512 locus=Lus10006512.g ID=Lus10006512.BGIv1.0 annot-version=v1.0
MLSPALLVITILLFLSAASWPSHAGDDGGRPSHLNFFRSSSRRPRQGYWCSRDDPEACLRNPRGGRTCCFGRVCKDTLRDGNNCGTCGEKCPFGFVCCDG
KCVDVRNDASHCGSCFQECRSGQRLCSFGMCDYAAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G50650 Stigma-specific Stig1 family p... Lus10006512 0 1
AT1G79700 AP2_ERF Integrase-type DNA-binding sup... Lus10005513 1.4 0.9277
AT5G19970 unknown protein Lus10019451 6.9 0.9205
AT4G28890 RING/U-box superfamily protein... Lus10011702 9.2 0.9059
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10034668 9.6 0.9085
AT4G01470 ATTIP1.3, GAMMA... tonoplast intrinsic protein 1;... Lus10040863 11.4 0.8986
AT5G12380 ANNAT8 annexin 8 (.1) Lus10019780 12.4 0.9059
AT2G25180 GARP ARR12 response regulator 12 (.1) Lus10019058 12.4 0.8538
AT5G04220 SYT3, NTMCTYPE1... synaptotagmin 3, Calcium-depen... Lus10026515 13.5 0.8862
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10009138 13.7 0.8797
AT3G63530 BB2, BB BIG BROTHER, RING/U-box superf... Lus10002554 13.9 0.8495

Lus10006512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.