Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012269 [exp] 114 / 3e-33 ND / Lus10007712 [exp] 95 / 3e-26 ND / Lus10006892 [exp] 91 / 6e-25 ND / Lus10008371 [exp] 86 / 7e-23 ND / Lus10033443 [exp] 54 / 2e-09 AT5G35560 856 / 0.0 DENN (AEX-3) domain-containing protein (.1) Lus10003221 [exp] 38 / 0.0004 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006529 pacid=23140010 polypeptide=Lus10006529 locus=Lus10006529.g ID=Lus10006529.BGIv1.0 annot-version=v1.0 ATGGCTGAGACGAATCTCAACCAAGACTGGCAATTCCGACTATGTGATTGCAAGTGTGGTGAGGTTTATTATTTCAGTGAATGGGTTGAGCTCTGTGAAT ATGTAAGGATTGACGGGGGTTCTCTAAAGTCAGGTACATTTCTTCAAGGACATATAATCAGTGTCATGGCTCAAAGTGTGAAGCTGGCCACGGTCGTCGA TGAGCTCAATAAGAGGATAAATGATATTGTCTACATCATGCGGATAGTGAGTGGTCATGCAGCTGCCATGACATCAGGTTGTCCCCGACCCTCATCCGAC CGTCCTGATGCCCATAAAAGACAAACGATGGGTTAG
AA sequence Show only first row Show all	>Lus10006529 pacid=23140010 polypeptide=Lus10006529 locus=Lus10006529.g ID=Lus10006529.BGIv1.0 annot-version=v1.0 MAETNLNQDWQFRLCDCKCGEVYYFSEWVELCEYVRIDGGSLKSGTFLQGHIISVMAQSVKLATVVDELNKRINDIVYIMRIVSGHAAAMTSGCPRPSSD RPDAHKRQTMG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006529 [exp]	0	1
					Lus10005297 [exp]	1.0	1.0000
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	1.4	1.0000
					Lus10013260 [exp]	1.7	1.0000
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10032426 [exp]	3.0	0.9848
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	4.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10011644 [exp]	4.7	0.9790
					Lus10035557 [exp]	5.0	1.0000
AT3G51240		TT6, F3'H, F3H	TRANSPARENT TESTA 6, flavanone...		Lus10041912 [exp]	5.5	0.9794
AT4G22880		TT18, TDS4, ANS...	TANNIN DEFICIENT SEED 4, ANTHO...		Lus10014134 [exp]	5.8	0.8941
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	6.0	1.0000

Compare expression of checked genes

Lus10006529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.