Lus10006538 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1)
AT5G39130 311 / 1e-108 RmlC-like cupins superfamily protein (.1)
AT5G39150 310 / 5e-108 RmlC-like cupins superfamily protein (.1)
AT5G39180 310 / 6e-108 RmlC-like cupins superfamily protein (.1)
AT5G39190 308 / 2e-107 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
AT5G39160 307 / 6e-107 RmlC-like cupins superfamily protein (.1.2.3)
AT5G39110 305 / 4e-106 RmlC-like cupins superfamily protein (.1)
AT3G05950 298 / 4e-103 RmlC-like cupins superfamily protein (.1)
AT5G38940 274 / 8e-94 RmlC-like cupins superfamily protein (.1)
AT4G14630 270 / 2e-92 GLP9 germin-like protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000622 432 / 5e-156 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1)
Lus10006536 424 / 6e-153 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Lus10003116 404 / 6e-145 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006543 394 / 3e-141 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10003114 394 / 3e-141 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10033767 390 / 1e-139 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Lus10021980 273 / 2e-93 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
Lus10003267 273 / 3e-93 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1)
Lus10042517 271 / 2e-92 AT5G39160 251 / 4e-85 RmlC-like cupins superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G026200 355 / 5e-126 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Potri.019G026400 349 / 2e-123 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026500 349 / 2e-123 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G025800 347 / 8e-123 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G025900 347 / 8e-123 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026000 347 / 8e-123 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026700 344 / 1e-121 AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G052100 304 / 1e-105 AT5G39110 285 / 2e-98 RmlC-like cupins superfamily protein (.1)
Potri.013G052000 304 / 1e-105 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Potri.013G051700 301 / 9e-105 AT3G05950 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10006538 pacid=23149212 polypeptide=Lus10006538 locus=Lus10006538.g ID=Lus10006538.BGIv1.0 annot-version=v1.0
ATGATGATGAAAGGCTCTTACTTCCTTGTAGCAGTTGGCTTCCTCTCAGTGTTGTCTTCATTTTGCTTCACCACTGCTTATGATCCAAGCCCTCTCCAAG
ATTTCTGCGTCGCCATTGATGATCCTAAGAACGGAGTATTCGTGAACGGCAAGTTCTGCAAGGATCCCATGCAGGCCAAAGCAGATGACTTCTCTTTCAA
AGGACTCAACGTCCCCCGAAACACATCCAACCAAGTTGGTTCGAACGTCACTCTTCTGAACGTTGACCAGATTCCGGGTCTCAACACCCTAGGAATCTCA
TTGGCTCGGCTCGACTACGCTCCTAACGGAGGGCTCAACCCACCGCACACCCACCCTCGTGGTACTGAGATTCTGGTTGTCATTCAAGGGACGCTATATG
TCGGGTTCGTTACCTCCAACCCGGATAATCGCCTCATCAGCAAGGTGCTTTACCCAGGTGATGTTTTCGTTTTCCCAATCGGTCTCATCCATTTCCAACT
CAACATCGCAAAGACTCCTGCCGTAGCGTTTGCCGGATTGAGCAGTCAGAATCCAGGTGTCATCACAATAGCCAATGCAGTTTTCGGCTCAAACGCACCG
GTCAACCCCGATGTGTTGACCAAGGCATTCCAGCTGGATAAGAATGTCGTGGCCGATCTACAGAAGAAGTTTGCCAAAAATTAA
AA sequence
>Lus10006538 pacid=23149212 polypeptide=Lus10006538 locus=Lus10006538.g ID=Lus10006538.BGIv1.0 annot-version=v1.0
MMMKGSYFLVAVGFLSVLSSFCFTTAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDPMQAKADDFSFKGLNVPRNTSNQVGSNVTLLNVDQIPGLNTLGIS
LARLDYAPNGGLNPPHTHPRGTEILVVIQGTLYVGFVTSNPDNRLISKVLYPGDVFVFPIGLIHFQLNIAKTPAVAFAGLSSQNPGVITIANAVFGSNAP
VNPDVLTKAFQLDKNVVADLQKKFAKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G39120 RmlC-like cupins superfamily p... Lus10006538 0 1
AT5G39150 RmlC-like cupins superfamily p... Lus10006536 1.0 0.9972
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10010545 4.0 0.9851
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10021257 4.2 0.9829
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10038200 5.0 0.9850
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10043308 5.5 0.9802
AT1G13080 CYP71B2 "cytochrome P450, family 71, s... Lus10043312 6.2 0.9861
AT1G68390 Core-2/I-branching beta-1,6-N-... Lus10005107 6.5 0.9851
AT2G45220 Plant invertase/pectin methyle... Lus10038917 6.5 0.9815
AT3G59710 NAD(P)-binding Rossmann-fold s... Lus10035736 9.5 0.9808
AT5G06860 ATPGIP1, PGIP1 polygalacturonase inhibiting p... Lus10021028 11.3 0.9731

Lus10006538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.