Lus10006539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006537 337 / 5e-120 ND /
Lus10000623 129 / 5e-39 ND /
Lus10035524 113 / 2e-31 ND /
Lus10016944 107 / 2e-29 ND /
Lus10001546 79 / 2e-18 ND /
Lus10027774 67 / 4e-14 ND /
Lus10039441 49 / 4e-07 ND /
Lus10039442 49 / 4e-07 ND /
Lus10004305 49 / 5e-07 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10006539 pacid=23149175 polypeptide=Lus10006539 locus=Lus10006539.g ID=Lus10006539.BGIv1.0 annot-version=v1.0
ATGGCGCAGGAGTTGGTAAGCCTGGAGTCCGACATACATTTCGTCCAAGCTAATTCCAATGGTAACGGCGTTAGTGTCTACGAGTACAAGGAGTATACCA
ACATTTTCGGCATGATTCATGCTAACTGTCCTCGTTGGACTCTGTTGGCAGAGGTAACAGGTGCTTCTCCTGGATTTTCGGGTCTGAACGTATTCGGTGT
AACGTTTTTGGCCGAGGGTTTGGATACTCTAGCTCGTGATTTGACCATCACTAGCGAAAATGGCGATAAGTTTCGTCTTGTAGTCAACCGCCAAGGCCTT
TGCTTCGTGTGTCTAAGTCAAAATGATCCAATAAAGTGGCTGAGAATCAGTGGCCTTTTCTGTTGGTCGAAGTATGGGGTGGCTAAACCTGATCTTCAAG
TGCGTGAAGCAGAAGCAAGCAATGGCGCCGTTTTGAAAGGTCCTCTGGCTATTATCGACGTGAATTCCGCGGAAATAGTAAGGGAGAAGAAGATGAAGAT
AGAGCAAATGGAGAAGGATCTGGCTTCCCTCAAGGCTACCTTGAAAGGCTTACCTAGCATCTAA
AA sequence
>Lus10006539 pacid=23149175 polypeptide=Lus10006539 locus=Lus10006539.g ID=Lus10006539.BGIv1.0 annot-version=v1.0
MAQELVSLESDIHFVQANSNGNGVSVYEYKEYTNIFGMIHANCPRWTLLAEVTGASPGFSGLNVFGVTFLAEGLDTLARDLTITSENGDKFRLVVNRQGL
CFVCLSQNDPIKWLRISGLFCWSKYGVAKPDLQVREAEASNGAVLKGPLAIIDVNSAEIVREKKMKIEQMEKDLASLKATLKGLPSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006539 0 1
AT1G56700 Peptidase C15, pyroglutamyl pe... Lus10001521 4.6 0.9398
Lus10011267 6.3 0.9334
AT5G49710 unknown protein Lus10000765 6.8 0.9493
AT4G17960 unknown protein Lus10000314 7.2 0.9386
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10022727 12.7 0.9411
AT2G32070 Polynucleotidyl transferase, r... Lus10018330 13.4 0.9284
AT2G01100 unknown protein Lus10015331 14.5 0.9270
AT5G26600 Pyridoxal phosphate (PLP)-depe... Lus10001514 14.8 0.8777
AT4G15940 Fumarylacetoacetate (FAA) hydr... Lus10006496 15.3 0.9227
AT2G29410 ATMTPB1, MTPB1 metal tolerance protein B1 (.1... Lus10016487 15.7 0.9279

Lus10006539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.