Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38960 74 / 3e-17 RmlC-like cupins superfamily protein (.1) AT3G04200 73 / 7e-17 RmlC-like cupins superfamily protein (.1) AT3G04150 73 / 1e-16 RmlC-like cupins superfamily protein (.1.2) AT5G39130 72 / 1e-16 RmlC-like cupins superfamily protein (.1) AT5G39190 72 / 1e-16 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G38910 71 / 3e-16 RmlC-like cupins superfamily protein (.1) AT5G39160 71 / 3e-16 RmlC-like cupins superfamily protein (.1.2.3) AT5G38940 69 / 2e-15 RmlC-like cupins superfamily protein (.1) AT4G14630 69 / 2e-15 GLP9 germin-like protein 9 (.1) AT3G04190 69 / 4e-15 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003267 [exp] 122 / 7e-36 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 77 / 2e-18 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006538 [exp] 77 / 4e-18 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10033767 [exp] 75 / 1e-17 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Lus10003114 [exp] 72 / 1e-16 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006543 [exp] 72 / 1e-16 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10032015 [exp] 72 / 2e-16 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3) Lus10006536 [exp] 72 / 2e-16 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Lus10035185 [exp] 72 / 2e-16 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G025800 [exp] 84 / 6e-21 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G025900 [exp] 84 / 6e-21 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026000 [exp] 84 / 6e-21 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026700 [exp] 83 / 1e-20 AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1) Potri.004G179855 [exp] 81 / 6e-20 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179888 [exp] 81 / 6e-20 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179833 [exp] 81 / 6e-20 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179844 [exp] 81 / 6e-20 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179800 [exp] 82 / 7e-20 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1) Potri.004G179811 [exp] 82 / 7e-20 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006549 pacid=23149195 polypeptide=Lus10006549 locus=Lus10006549.g ID=Lus10006549.BGIv1.0 annot-version=v1.0 ATGCATGTTAATAATGTGACGCATGCAGATGCAGTATTCGTGAACGGGAGAGCATGTAAGAACCCATCGTTGGCAACCATAGACGACTTCACTTTCTCAG GGCTCAACGTCCCACGTGACACTCGCAACAACATTGGAGGCAAGATAACGGTTGTGGACTCGACCGTTATCCCCGGGATGAACACCTTGGGGATCAACTT GGTTCGGATCGACCTGGCTGCCAACGGAGGGTTGAACCCGCCCCCCGCGGAACCCGCCCCACGAGCACCCCCGTGCTTCCGAGGTCCTGTACGTGGTGGA GGGAACTCTCTACGCGGGATTCGTCACCACCAACCCTGA
AA sequence Show only first row Show all	>Lus10006549 pacid=23149195 polypeptide=Lus10006549 locus=Lus10006549.g ID=Lus10006549.BGIv1.0 annot-version=v1.0 MHVNNVTHADAVFVNGRACKNPSLATIDDFTFSGLNVPRDTRNNIGGKITVVDSTVIPGMNTLGINLVRIDLAANGGLNPPPAEPAPRAPPCFRGPVRGG GNSLRGIRHHQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04200			RmlC-like cupins superfamily p...		Lus10006549 [exp]	0	1
AT5G38960			RmlC-like cupins superfamily p...		Lus10006550 [exp]	1.0	0.9973
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10042210 [exp]	4.2	0.8735
AT5G01880			RING/U-box superfamily protein...		Lus10025144 [exp]	16.1	0.7579
AT3G22890		APS1	ATP sulfurylase 1 (.1)		Lus10006629 [exp]	18.7	0.8415
AT5G64120			Peroxidase superfamily protein...		Lus10007050 [exp]	26.3	0.8439
AT5G38200			Class I glutamine amidotransfe...		Lus10009152 [exp]	26.5	0.7914
AT5G08790	NAC	ATAF2, ANAC081	Arabidopsis NAC domain contain...		Lus10002083 [exp]	27.3	0.7538
AT1G73370		ATSUS6, SUS6	ARABIDOPSIS THALIANA SUCROSE S...		Lus10007372 [exp]	28.5	0.7728
AT5G39130			RmlC-like cupins superfamily p...		Lus10003267 [exp]	28.8	0.8271
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10025733 [exp]	33.5	0.8257

Compare expression of checked genes

Lus10006549 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.