Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38960 90 / 3e-24 RmlC-like cupins superfamily protein (.1) AT5G38940 87 / 5e-23 RmlC-like cupins superfamily protein (.1) AT5G39130 86 / 1e-22 RmlC-like cupins superfamily protein (.1) AT5G39190 86 / 1e-22 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39160 86 / 1e-22 RmlC-like cupins superfamily protein (.1.2.3) AT5G38930 85 / 3e-22 RmlC-like cupins superfamily protein (.1) AT5G38910 82 / 3e-21 RmlC-like cupins superfamily protein (.1) AT5G39100 80 / 3e-21 GLP6 germin-like protein 6 (.1) AT5G38950 80 / 3e-21 RmlC-like cupins superfamily protein (.1) AT5G39150 82 / 4e-21 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003267 [exp] 142 / 2e-44 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 87 / 9e-23 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10000622 [exp] 85 / 4e-22 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1) Lus10021980 [exp] 85 / 5e-22 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3) Lus10042517 [exp] 84 / 7e-22 AT5G39160 251 / 4e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10006543 [exp] 84 / 1e-21 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10003114 [exp] 84 / 1e-21 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006538 [exp] 83 / 3e-21 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10006536 [exp] 83 / 3e-21 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G051800 [exp] 88 / 1e-23 AT3G05950 245 / 8e-83 RmlC-like cupins superfamily protein (.1) Potri.013G063200 [exp] 88 / 3e-23 AT5G39130 228 / 5e-76 RmlC-like cupins superfamily protein (.1) Potri.009G140350 [exp] 87 / 4e-23 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Potri.013G063001 [exp] 87 / 4e-23 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G063100 [exp] 87 / 4e-23 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G062950 [exp] 87 / 4e-23 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1) Potri.013G064100 [exp] 87 / 5e-23 AT5G39130 282 / 5e-97 RmlC-like cupins superfamily protein (.1) Potri.013G051700 [exp] 87 / 6e-23 AT3G05950 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Potri.013G051600 [exp] 87 / 8e-23 AT3G05950 296 / 1e-102 RmlC-like cupins superfamily protein (.1) Potri.004G180000 [exp] 87 / 9e-23 AT5G39130 250 / 2e-84 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006550 pacid=23149199 polypeptide=Lus10006550 locus=Lus10006550.g ID=Lus10006550.BGIv1.0 annot-version=v1.0 ATGATTCATTTCCAGTACAACATCGGAAAGACTCCTGGTTTGGCCTTTGCGGCGCTGGGGAGCCAGAACCCTGGTATCATGACCATCGGGAATTCGATGT TCGGAGCTAATCCGCCAATTGACGTGGCAATGTTGGCTAAGGCGTTTCAGATTGATGAGAAGGTTGTGAGGGAGCTTCAGAAGAAGACATGGGTTAATCC TGAAGAGTAA
AA sequence Show only first row Show all	>Lus10006550 pacid=23149199 polypeptide=Lus10006550 locus=Lus10006550.g ID=Lus10006550.BGIv1.0 annot-version=v1.0 MIHFQYNIGKTPGLAFAALGSQNPGIMTIGNSMFGANPPIDVAMLAKAFQIDEKVVRELQKKTWVNPEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38960			RmlC-like cupins superfamily p...		Lus10006550 [exp]	0	1
AT3G04200			RmlC-like cupins superfamily p...		Lus10006549 [exp]	1.0	0.9973
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10042210 [exp]	2.0	0.8970
AT5G01880			RING/U-box superfamily protein...		Lus10025144 [exp]	12.1	0.7681
AT1G73370		ATSUS6, SUS6	ARABIDOPSIS THALIANA SUCROSE S...		Lus10007372 [exp]	12.6	0.7891
AT3G22890		APS1	ATP sulfurylase 1 (.1)		Lus10006629 [exp]	20.6	0.8423
AT5G64120			Peroxidase superfamily protein...		Lus10007050 [exp]	25.9	0.8502
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10011958 [exp]	26.8	0.8522
AT5G08790	NAC	ATAF2, ANAC081	Arabidopsis NAC domain contain...		Lus10002083 [exp]	32.1	0.7530
AT5G66740			Protein of unknown function (D...		Lus10014323 [exp]	32.4	0.7891
AT2G30150			UDP-Glycosyltransferase superf...		Lus10042262 [exp]	36.5	0.8045

Compare expression of checked genes

Lus10006550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.