Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04720 66 / 2e-14 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003265 [exp] 97 / 8e-27 AT3G04720 202 / 8e-67 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006557 [exp] 87 / 1e-22 AT3G04720 191 / 2e-62 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006552 [exp] 85 / 1e-21 AT3G04720 244 / 1e-82 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003262 [exp] 82 / 4e-21 AT3G04720 154 / 2e-48 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003266 [exp] 76 / 6e-19 AT3G04720 89 / 2e-23 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003264 [exp] 73 / 1e-17 AT3G04720 181 / 1e-58 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10006556 [exp] 72 / 5e-17 AT3G04720 186 / 1e-60 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10003588 [exp] 48 / 8e-08 AT3G04720 128 / 1e-37 HEVEIN-LIKE, pathogenesis-related 4 (.1) Lus10020252 [exp] 47 / 1e-07 AT3G04720 135 / 4e-40 HEVEIN-LIKE, pathogenesis-related 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G054000 [exp] 80 / 5e-20 AT3G04720 238 / 9e-81 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041900 [exp] 80 / 5e-20 AT3G04720 251 / 1e-85 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041700 [exp] 79 / 3e-19 AT3G04720 248 / 4e-84 HEVEIN-LIKE, pathogenesis-related 4 (.1) Potri.013G041600 [exp] 74 / 2e-17 AT3G04720 266 / 3e-91 HEVEIN-LIKE, pathogenesis-related 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF00967 [flax] [poplar] Barwin Barwin family
Representative CDS sequence Show only first row Show all	>Lus10006553 pacid=23149187 polypeptide=Lus10006553 locus=Lus10006553.g ID=Lus10006553.BGIv1.0 annot-version=v1.0 ATGGAGAGATTAAGTGCAGCGCTGTTATTCACTCTGCTGCTGGGTTTGTTTTCTGCGATTGCCAGCGGGCAGAGTGCTTCAAATTGCTTATTGCTCCACG TGGGATGCCAACAAGCCCTTGGCCTGGCGCCAGCCGCTGGACCCCATGGCCAAGCCGCTTGCGACCGCTGCTTGAAGGTGACGAACAGAGCAACAAGGGC GGAAGCGACAATGAGAATTGTGGACCAGTGTAGTAATGGAGGGCTGGATCTCGACGTCAATGTTTTCAGGAGGATTGATACCGACGGAAGGGGAAATGCT CAAGGCCAATCTCATGATTGA
AA sequence Show only first row Show all	>Lus10006553 pacid=23149187 polypeptide=Lus10006553 locus=Lus10006553.g ID=Lus10006553.BGIv1.0 annot-version=v1.0 MERLSAALLFTLLLGLFSAIASGQSASNCLLLHVGCQQALGLAPAAGPHGQAACDRCLKVTNRATRAEATMRIVDQCSNGGLDLDVNVFRRIDTDGRGNA QGQSHD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006553 [exp]	0	1
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10021193 [exp]	2.6	0.8459
AT2G32390		GLR6, ATGLR3.5	glutamate receptor 3.5 (.1.2....		Lus10025426 [exp]	5.8	0.8417
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10001775 [exp]	15.5	0.8253
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031238 [exp]	15.5	0.7597
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031237 [exp]	29.5	0.7800
					Lus10010256 [exp]	58.9	0.6746
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	72.8	0.7558
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10019801 [exp]	104.1	0.7368
AT1G70690		HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN ...		Lus10030779 [exp]	108.2	0.6670
					Lus10036864 [exp]	134.1	0.7033

Compare expression of checked genes

Lus10006553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.