Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005525 [exp] 186 / 1e-62 ND 40 / 1e-05 Lus10041164 [exp] 59 / 2e-12 ND 34 / 0.002 Lus10014739 [exp] 44 / 2e-06 ND 40 / 2e-05 Lus10024872 [exp] 44 / 2e-06 ND 39 / 3e-05 Lus10024873 [exp] 43 / 4e-06 ND 37 / 2e-04 Lus10000703 [exp] 37 / 0.0007 AT1G06135 44 / 3e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G043600 [exp] 66 / 4e-15 AT1G06135 39 / 3e-05 unknown protein Potri.019G013000 [exp] 57 / 2e-11 AT2G31335 / unknown protein Potri.019G012700 [exp] 54 / 3e-10 AT2G31335 / unknown protein Potri.002G041950 [exp] 52 / 2e-09 AT2G31335 / unknown protein Potri.019G012400 [exp] 51 / 2e-09 AT2G31335 / unknown protein Potri.019G012603 [exp] 49 / 9e-09 AT2G31335 / unknown protein Potri.001G380300 [exp] 47 / 1e-07 AT1G06137 40 / 2e-05 unknown protein Potri.008G163000 [exp] 46 / 2e-07 AT2G31335 40 / 1e-05 unknown protein Potri.019G012601 [exp] 44 / 9e-07 AT2G31335 / unknown protein Potri.005G221200 [exp] 44 / 1e-06 AT2G31335 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006567 pacid=23149171 polypeptide=Lus10006567 locus=Lus10006567.g ID=Lus10006567.BGIv1.0 annot-version=v1.0 ATGGGTTCTGCAAAAGTCGGCAGCTTTTCATCGACCAGAATAGCAGCGTCGCTAATGCTCGTGGTCGTTTTACTTATGGCGTCGTGCTACCGGGAAACAG CGGCGGCGAGGCCGCTTTTGGAGATAAACATCCAGTCGCTACAGAGGGGACCAGTGCCGTCGTCCAAATCGTCGCCGTGCGGTCACGTACCCAACCGCGG GACTGGCAAATGCACTTTGGCTGGGATGAACGTCGCCGGAGAGGGTCTCCGTGTTCGATCCCCTCCGGCGCCGGTGGAGGCGCACCCGGTGGCTGATAAT GTTGTCGTCATGGAAGCAGCCGTGGGATTAAATTTACAGAAAGAGGCTTGA
AA sequence Show only first row Show all	>Lus10006567 pacid=23149171 polypeptide=Lus10006567 locus=Lus10006567.g ID=Lus10006567.BGIv1.0 annot-version=v1.0 MGSAKVGSFSSTRIAASLMLVVVLLMASCYRETAAARPLLEINIQSLQRGPVPSSKSSPCGHVPNRGTGKCTLAGMNVAGEGLRVRSPPAPVEAHPVADN VVVMEAAVGLNLQKEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006567 [exp]	0	1
					Lus10005525 [exp]	1.0	0.9943
					Lus10041163 [exp]	4.7	0.9907
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Lus10015546 [exp]	7.2	0.9883
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10021314 [exp]	7.3	0.9886
AT3G48180			unknown protein		Lus10043469 [exp]	8.9	0.9861
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10023280 [exp]	9.9	0.9845
AT3G61510		AT-ACS1, ACS1	ARABIDOPSIS THALIANA 1-AMINOCY...		Lus10036396 [exp]	10.7	0.9867
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10041145 [exp]	11.1	0.9733
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10041973 [exp]	13.8	0.9867
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Lus10020023 [exp]	13.8	0.9854

Compare expression of checked genes

Lus10006567 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.