Lus10006575 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52820 221 / 3e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 202 / 8e-64 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52800 169 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52790 169 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 151 / 5e-44 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 136 / 7e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 127 / 5e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 104 / 2e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 94 / 4e-22 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G23340 82 / 3e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005516 440 / 5e-157 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016659 235 / 6e-77 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 212 / 9e-68 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023160 172 / 4e-53 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008097 140 / 8e-40 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10013132 132 / 9e-37 AT1G52800 222 / 8e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10041281 128 / 4e-36 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773 126 / 2e-34 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005776 124 / 7e-34 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176200 252 / 1e-83 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 235 / 7e-77 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 229 / 2e-74 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400 174 / 5e-53 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 173 / 3e-52 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176500 161 / 5e-48 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176000 156 / 4e-46 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 128 / 2e-35 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G106900 89 / 1e-20 AT4G23340 392 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.011G146600 83 / 1e-18 AT1G14130 366 / 6e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10006575 pacid=23149198 polypeptide=Lus10006575 locus=Lus10006575.g ID=Lus10006575.BGIv1.0 annot-version=v1.0
ATGAACGAGTTGCTGGTTAAAGTGTTTGAGCTTCCTTTGGAGGCGAAGCAGAGAAATGTTTCTGAAAAGCCTTTCCATGGCTATTTTGCTTCCTCACCTG
TGAACCCTTGGTTCGAGAGCTTAGGGGTCGATGATCCTGAAAGCTTCGACAAGGTTGGAAGTCTGACAAACGCCCTTTGGCCAGAAGGACAAAAGAAAAT
TCAGGCGTCAAGATTAGATCAAGTGGTGAGGAGAATGATTCTGGAGGGTCTTGGAGTTGATAAGTATATGGAAGAACATATGAAGTCAAGTACATATACA
TTGAGAATGATGAGATATGAAGCACCCGGAAACAGCGACAGAACAATCAGGATGAAACCTCACACAGACAAGAACGTCATCAGCATTTTCCACCAGCACC
AGGCTGATGTACTCAAACTACAGGCCAAATCTGGCGAGTGGTTCGCTGCGAATTTCCAGCCCGATTGGTCTTTCCTAGTTGTATTGGGAGAATCCTTCCA
TGCATGGACAAATGGTAGATTGTATTCTCCCGTTCATCGAGCTGTGATGACAGGAAACAATGCAATGTACTCTGCTGGATTGTTCTCAGTTCCGAGAGAC
GGGTATTTTGTAAAAGCTCCAGAGGAGATGGTAGATGATGATAAGCATCCTTTGTTGCTTGGGCCTTTTGATTATTCTGAGTACCTGAAGCTCAGGTTTG
CTGATATTGGTTGTACCCTTCACTCAAAACATTATTTTGGTCGACCCAATTGA
AA sequence
>Lus10006575 pacid=23149198 polypeptide=Lus10006575 locus=Lus10006575.g ID=Lus10006575.BGIv1.0 annot-version=v1.0
MNELLVKVFELPLEAKQRNVSEKPFHGYFASSPVNPWFESLGVDDPESFDKVGSLTNALWPEGQKKIQASRLDQVVRRMILEGLGVDKYMEEHMKSSTYT
LRMMRYEAPGNSDRTIRMKPHTDKNVISIFHQHQADVLKLQAKSGEWFAANFQPDWSFLVVLGESFHAWTNGRLYSPVHRAVMTGNNAMYSAGLFSVPRD
GYFVKAPEEMVDDDKHPLLLGPFDYSEYLKLRFADIGCTLHSKHYFGRPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10006575 0 1

Lus10006575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.