Lus10006582 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17010 165 / 5e-53 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001160 248 / 7e-86 AT4G17010 166 / 3e-53 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G038600 189 / 1e-62 AT4G17010 140 / 4e-43 unknown protein
PFAM info
Representative CDS sequence
>Lus10006582 pacid=23162684 polypeptide=Lus10006582 locus=Lus10006582.g ID=Lus10006582.BGIv1.0 annot-version=v1.0
ATGAACAAGTTACTGGACTTTGGGAGGAAGGCTTTTTTCTACGTGAGGGTTCTTTCAGGGTATGAAGAACGCCGAATCCGGAATTATAGGTTGGAGCTGG
AGAAGCGTCTTCAACAGGCACAGGAGAAAAAGTTGGCCTTGAGAAAGATCCCTGAGCAGACTATACTTTCAGAAGTTCGCTCTATGGTTGAGGAAATGCA
AGCTCTGAACAAGAAGCTGGAAGAAACTGAGGCTCAAATTGATGACTACTTCAAGCCAATTAACATGAAAGCTGAGATCCTAATGAAACAACAGCTTGAG
GGGGAGGAGAGGACAATGACGGAGATGATGAAGGTTATGCAAACTAAAGCTTTGATTGAGGAAGCCCAAGCTGCTAGTACATCAATATCAGACCGACAAG
CAGGAAATACAATCTCCCCCAACCAAGCAGGATAA
AA sequence
>Lus10006582 pacid=23162684 polypeptide=Lus10006582 locus=Lus10006582.g ID=Lus10006582.BGIv1.0 annot-version=v1.0
MNKLLDFGRKAFFYVRVLSGYEERRIRNYRLELEKRLQQAQEKKLALRKIPEQTILSEVRSMVEEMQALNKKLEETEAQIDDYFKPINMKAEILMKQQLE
GEERTMTEMMKVMQTKALIEEAQAASTSISDRQAGNTISPNQAG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17010 unknown protein Lus10006582 0 1
AT3G25210 Tetratricopeptide repeat (TPR)... Lus10038215 2.0 0.8854
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10003760 3.5 0.8460
AT2G04900 unknown protein Lus10001166 4.9 0.8498
AT5G57860 Ubiquitin-like superfamily pro... Lus10036598 5.0 0.8314
AT1G76200 unknown protein Lus10016001 8.0 0.8379
AT1G31812 ACBP6, ACBP acyl-CoA-binding protein 6 (.1... Lus10013605 9.5 0.8070
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10004085 14.0 0.7495
AT5G09920 NRPB4, ATRPB15.... RNA polymerase II, Rpb4, core ... Lus10005796 18.3 0.7724
AT1G12390 Cornichon family protein (.1) Lus10009295 20.0 0.7920
Lus10007667 21.2 0.8192

Lus10006582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.