Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012077 [exp] 101 / 6e-28 AT5G27260 50 / 5e-07 unknown protein Lus10014160 [exp] 86 / 3e-22 ND 47 / 6e-06 Lus10011704 [exp] 79 / 2e-20 ND / Lus10035759 [exp] 69 / 1e-15 AT5G27260 74 / 6e-15 unknown protein Lus10037335 [exp] 68 / 3e-15 AT5G27260 69 / 7e-13 unknown protein Lus10024751 [exp] 66 / 3e-15 AT1G30140 54 / 4e-09 unknown protein Lus10032348 [exp] 53 / 7e-10 AT5G27260 52 / 2e-07 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006591 pacid=23162681 polypeptide=Lus10006591 locus=Lus10006591.g ID=Lus10006591.BGIv1.0 annot-version=v1.0 ATGGTGATGATTGACGAGACTTTATATGCTGATTACGTAAAGCATCATACCAACTATGCTCGCCTAAACCGTGTTTTGTTCCCGTTGTATGATGCATTAG AGTATGTTTTTGGGAACAGGCGTGTGACGAGCTGTAAGGTTTTTAGTGTGGAAGAATTAAAGAACTCATGCCCTCCAATTGAAATTCTAGCAAATTTAGT GCTTGGTTAG
AA sequence Show only first row Show all	>Lus10006591 pacid=23162681 polypeptide=Lus10006591 locus=Lus10006591.g ID=Lus10006591.BGIv1.0 annot-version=v1.0 MVMIDETLYADYVKHHTNYARLNRVLFPLYDALEYVFGNRRVTSCKVFSVEELKNSCPPIEILANLVLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006591 [exp]	0	1
					Lus10006652 [exp]	7.7	0.8350
AT4G38870			F-box and associated interacti...		Lus10034309 [exp]	10.2	0.8545
AT5G60370			unknown protein		Lus10023342 [exp]	11.2	0.8680
AT3G06720		IMPA1, IMPA-1, ...	importin alpha isoform 1 (.1.2...		Lus10001534 [exp]	19.8	0.8640
AT5G48090		ELP1	EDM2-like protein1 (.1.2)		Lus10002268 [exp]	27.3	0.8610
AT4G32050			neurochondrin family protein (...		Lus10001536 [exp]	32.4	0.8102
AT5G11320		YUC4	YUCCA4, Flavin-binding monooxy...		Lus10008092 [exp]	33.6	0.8541
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10019105 [exp]	39.8	0.8434
AT4G18220			Drug/metabolite transporter su...		Lus10042836 [exp]	55.7	0.7689
					Lus10000191 [exp]	66.9	0.8301

Compare expression of checked genes

Lus10006591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.