Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 168 / 2e-54 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 162 / 2e-52 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G26340 41 / 3e-05 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G13060 41 / 3e-05 PBE1 20S proteasome beta subunit E1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039351 [exp] 204 / 2e-68 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10041194 [exp] 184 / 7e-61 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10021909 [exp] 179 / 6e-59 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1) Lus10011369 [exp] 39 / 0.0002 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10006426 [exp] 38 / 0.0004 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G155500 [exp] 186 / 2e-61 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.010G084800 [exp] 185 / 3e-61 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.010G058100 [exp] 38 / 0.0003 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.008G177000 [exp] 38 / 0.0003 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10006596 pacid=23145337 polypeptide=Lus10006596 locus=Lus10006596.g ID=Lus10006596.BGIv1.0 annot-version=v1.0 ATGGCTGGCTTTGACAAGGAGACTGGACCGTCTTTGTATTACATCGACTACATCGCTACCCTTCATAAAGTCGATAGGGGAGTGTTTGGTTATGGTTCCT ACTTCTGCCTTTCCATGATGGATAGACTCTATCACAGTGGCATGACCGTGGATAAAGCGATTGATCTGGTAGATAAGTGCATACTGGAGATCCGGTCGAG ATTGGTAGTAGCACCGCCGAACTTCTTCATTAAGATCGTCGACAAGGATGGAGCAAGGGAGTATGCCTGGCGTGAATCGGTGAAGGATGGTGCATCAGCT TAA
AA sequence Show only first row Show all	>Lus10006596 pacid=23145337 polypeptide=Lus10006596 locus=Lus10006596.g ID=Lus10006596.BGIv1.0 annot-version=v1.0 MAGFDKETGPSLYYIDYIATLHKVDRGVFGYGSYFCLSMMDRLYHSGMTVDKAIDLVDKCILEIRSRLVVAPPNFFIKIVDKDGAREYAWRESVKDGASA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10006596 [exp]	0	1
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	2.2	0.9042
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	2.4	0.8778
AT3G06430		AtPPR2, EMB2750	pentatricopeptide repeat 2, em...		Lus10039311 [exp]	3.2	0.8409
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	4.0	0.8816
AT5G23200			unknown protein		Lus10017393 [exp]	4.5	0.8119
AT3G07190			B-cell receptor-associated pro...		Lus10025914 [exp]	4.5	0.8613
AT5G62810		ATPEX14, PED2, ...	PEROXISOME DEFECTIVE 2, peroxi...		Lus10039935 [exp]	4.9	0.8719
AT5G01910			unknown protein		Lus10035364 [exp]	6.0	0.8233
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	6.5	0.8585
AT1G09190			Tetratricopeptide repeat (TPR)...		Lus10029853 [exp]	6.5	0.8359

Compare expression of checked genes

Lus10006596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.