Lus10006607 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G03080 59 / 1e-10 kinase interacting (KIP1-like) family protein (.1)
AT3G22790 54 / 5e-09 Kinase interacting (KIP1-like) family protein (.1)
AT4G14760 53 / 9e-09 kinase interacting (KIP1-like) family protein (.1)
AT4G02710 50 / 1e-07 Kinase interacting (KIP1-like) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039359 244 / 3e-75 AT3G22790 1402 / 0.0 Kinase interacting (KIP1-like) family protein (.1)
Lus10021908 112 / 2e-29 AT4G14760 710 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Lus10041192 109 / 2e-28 AT4G14760 744 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Lus10014687 50 / 1e-07 AT1G03080 938 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Lus10006896 44 / 2e-05 AT1G03080 927 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Lus10042627 42 / 8e-05 AT4G02710 624 / 0.0 Kinase interacting (KIP1-like) family protein (.1)
Lus10022079 42 / 0.0001 AT1G03080 1179 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G083300 120 / 3e-32 AT3G22790 1306 / 0.0 Kinase interacting (KIP1-like) family protein (.1)
Potri.008G156200 112 / 3e-29 AT3G22790 762 / 0.0 Kinase interacting (KIP1-like) family protein (.1)
Potri.002G049600 68 / 8e-14 AT1G03080 1229 / 0.0 kinase interacting (KIP1-like) family protein (.1)
Potri.005G213400 58 / 2e-10 AT1G03080 1399 / 0.0 kinase interacting (KIP1-like) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10006607 pacid=23145324 polypeptide=Lus10006607 locus=Lus10006607.g ID=Lus10006607.BGIv1.0 annot-version=v1.0
ATGAAAGCCAAGCTAGAAATGACAAGGAAATTGAGTAAGAAACCAAACATCATTGAGTTGGAAAAGGTGAAGATGAGGCTGCAAGATGTGGAAGAGGCAG
TTGTCCAGCTGGCTGAAGCTAATGATCATCTGAGGAAGGATGTTGGGGAGAGGTCCACCTCATCTCCAGAAGAGATGATGATCGCAGCGGAGAGAAATGG
AGTAACTGAGCAGGCAAGAAAAGAGTCAGAGAAGTTGGGAAGATTGCAGTTTGAAGTGCAGAACATCCAATACGTGCTGCTGAAACTCGATGGCGAGAAT
GACAAGAATGGGAAGAAGAACAAGGTGCAGAGATTTTATGGGAGCAGAACAGGAGTGCTGTTGAGGGATTTCATCAGCAGTGGGAAGAGGAGGAGCTTGA
GGAGAAAGAAGAAGTCGTGTTTCTGCGGATGTGGGAGACCGGCAGCCATTGAAGATTGA
AA sequence
>Lus10006607 pacid=23145324 polypeptide=Lus10006607 locus=Lus10006607.g ID=Lus10006607.BGIv1.0 annot-version=v1.0
MKAKLEMTRKLSKKPNIIELEKVKMRLQDVEEAVVQLAEANDHLRKDVGERSTSSPEEMMIAAERNGVTEQARKESEKLGRLQFEVQNIQYVLLKLDGEN
DKNGKKNKVQRFYGSRTGVLLRDFISSGKRRSLRRKKKSCFCGCGRPAAIED

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G03080 kinase interacting (KIP1-like)... Lus10006607 0 1
AT4G14200 Pentatricopeptide repeat (PPR)... Lus10041255 2.0 0.8113
AT5G41685 Mitochondrial outer membrane t... Lus10004754 3.9 0.7387
AT3G53540 unknown protein Lus10025295 5.7 0.7503
AT5G01090 Concanavalin A-like lectin fam... Lus10027751 6.3 0.7252
AT1G75310 AUL1 auxilin-like 1, auxin-like 1 p... Lus10041769 14.4 0.7353
AT3G51670 SEC14 cytosolic factor family ... Lus10012219 18.8 0.7350
AT3G14080 Small nuclear ribonucleoprotei... Lus10013161 25.0 0.6913
AT5G10660 calmodulin-binding protein-rel... Lus10042442 25.6 0.6348
AT5G67260 CYCD3;2 CYCLIN D3;2 (.1) Lus10019317 25.7 0.7166
AT4G30850 HHP2 heptahelical transmembrane pr... Lus10036605 31.5 0.6831

Lus10006607 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.