Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006608 pacid=23145310 polypeptide=Lus10006608 locus=Lus10006608.g ID=Lus10006608.BGIv1.0 annot-version=v1.0 ATGGCGGTAAGAATGTTTTGTATGAACTGCAGAAGTGTTTGCCTTTGTCAATTGAATTGCTGGCAAAGCATTGGTGGAGGAAGTGGATCTATGTTTAGAA TCATAAATGAGGCACTTGTCAAGCTAGGAAGTAAACCACGGAAAATTGTTAGTTGTCCAGTGCTAACTCCTGACATGGCAGGTTCTCTCTTCGCCAAATC TCCACGAACAGCCAATGAGCAGCAGCATGTACAGCATTACCAGTAG
AA sequence Show only first row Show all	>Lus10006608 pacid=23145310 polypeptide=Lus10006608 locus=Lus10006608.g ID=Lus10006608.BGIv1.0 annot-version=v1.0 MAVRMFCMNCRSVCLCQLNCWQSIGGGSGSMFRIINEALVKLGSKPRKIVSCPVLTPDMAGSLFAKSPRTANEQQHVQHYQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006608 [exp]	0	1
AT5G13780			Acyl-CoA N-acyltransferases (N...		Lus10019745 [exp]	2.4	0.8132
AT3G16840			P-loop containing nucleoside t...		Lus10004404 [exp]	3.9	0.8033
AT2G19640		SDG39, ASHR2	SET DOMAIN PROTEIN 39, ASH1-re...		Lus10026687 [exp]	18.0	0.8120
AT4G36130			Ribosomal protein L2 family (....		Lus10028468 [exp]	19.8	0.8050
AT5G03070		IMPA-9	importin alpha isoform 9 (.1)		Lus10008480 [exp]	22.7	0.7869
AT2G15690			Tetratricopeptide repeat (TPR)...		Lus10019864 [exp]	26.0	0.7781
AT3G60830		ATARP7	actin-related protein 7 (.1)		Lus10029510 [exp]	28.7	0.8000
AT2G37230			Tetratricopeptide repeat (TPR)...		Lus10021645 [exp]	35.1	0.7785
AT3G16080			Zinc-binding ribosomal protein...		Lus10035878 [exp]	35.1	0.7891
AT1G62740		Hop2	Hop2, stress-inducible protein...		Lus10024597 [exp]	38.0	0.7169

Compare expression of checked genes

Lus10006608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.