Lus10006610 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22800 160 / 8e-48 Leucine-rich repeat (LRR) family protein (.1)
AT3G24480 149 / 2e-43 Leucine-rich repeat (LRR) family protein (.1)
AT4G13340 144 / 1e-40 LRX3 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
AT4G18670 141 / 1e-39 Leucine-rich repeat (LRR) family protein (.1)
AT1G62440 136 / 4e-38 LRX2 leucine-rich repeat/extensin 2 (.1)
AT1G12040 129 / 2e-35 LRX1 leucine-rich repeat/extensin 1 (.1)
AT4G28380 123 / 1e-34 Leucine-rich repeat (LRR) family protein (.1)
AT5G25550 112 / 3e-30 Leucine-rich repeat (LRR) family protein (.1)
AT2G15880 113 / 5e-30 Leucine-rich repeat (LRR) family protein (.1)
AT4G33970 112 / 1e-29 Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039362 272 / 2e-92 AT3G22800 416 / 2e-143 Leucine-rich repeat (LRR) family protein (.1)
Lus10006611 153 / 1e-45 AT3G22800 434 / 3e-150 Leucine-rich repeat (LRR) family protein (.1)
Lus10017727 148 / 3e-42 AT3G24480 611 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10041190 144 / 3e-42 AT3G22800 421 / 3e-145 Leucine-rich repeat (LRR) family protein (.1)
Lus10039363 147 / 4e-42 AT3G22800 447 / 1e-152 Leucine-rich repeat (LRR) family protein (.1)
Lus10033672 135 / 1e-38 AT4G28380 488 / 6e-173 Leucine-rich repeat (LRR) family protein (.1)
Lus10037905 120 / 6e-33 AT4G13340 432 / 9e-149 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
Lus10028097 112 / 2e-29 AT1G62440 466 / 7e-157 leucine-rich repeat/extensin 2 (.1)
Lus10027935 112 / 2e-29 AT1G49490 538 / 6e-180 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G083100 170 / 1e-52 AT3G22800 447 / 2e-156 Leucine-rich repeat (LRR) family protein (.1)
Potri.010G083000 162 / 3e-49 AT3G22800 477 / 7e-167 Leucine-rich repeat (LRR) family protein (.1)
Potri.006G158814 156 / 8e-46 AT3G24480 614 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G075900 152 / 8e-44 AT3G24480 603 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G151000 149 / 3e-43 AT1G62440 533 / 0.0 leucine-rich repeat/extensin 2 (.1)
Potri.006G081200 149 / 1e-42 AT1G62440 553 / 0.0 leucine-rich repeat/extensin 2 (.1)
Potri.007G139200 135 / 6e-39 AT4G28380 503 / 9e-179 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G035100 135 / 9e-38 AT3G24480 483 / 4e-166 Leucine-rich repeat (LRR) family protein (.1)
Potri.006G245600 134 / 9e-38 AT3G24480 516 / 3e-180 Leucine-rich repeat (LRR) family protein (.1)
Potri.014G036700 115 / 1e-30 AT2G15880 502 / 1e-170 Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10006610 pacid=23145339 polypeptide=Lus10006610 locus=Lus10006610.g ID=Lus10006610.BGIv1.0 annot-version=v1.0
ATGGCGGAGACGCTGGATGAGATTATCCTCTCCAATTTGGGGCTTTCGGGTTGCTTGAGGCCCGAGATTGGCGAACTGAAGGAGCTCAAGGTACTCGATC
TGAGCTGTAATAAATTGATTGGGCCGTTGCCTGAATCTATTGCCGGGATGAAGAATTTGGAGCAGCTGGACGTCGGGCATAACAAGCTGTCGGGTCGGAT
CCCTAAGGGGATTTGCTTGCTCCCGAATTTGGAAAATTTCATGTACAAGAATAATTACTTCACCGGGGAGCCGCCGGAGTGTTTGAGGCTGGGAGCAGGG
AACAATGACCGGAAGAATTGTATTCCGGGGAGGCCGGGGCAGCGGTCGGCGGCGGAGTGCGCCTTGTTTAATGCAAATCCATTTGATTGCGCTGCCAGTA
TTTGCCCGCTTCAGTAA
AA sequence
>Lus10006610 pacid=23145339 polypeptide=Lus10006610 locus=Lus10006610.g ID=Lus10006610.BGIv1.0 annot-version=v1.0
MAETLDEIILSNLGLSGCLRPEIGELKELKVLDLSCNKLIGPLPESIAGMKNLEQLDVGHNKLSGRIPKGICLLPNLENFMYKNNYFTGEPPECLRLGAG
NNDRKNCIPGRPGQRSAAECALFNANPFDCAASICPLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22800 Leucine-rich repeat (LRR) fami... Lus10006610 0 1
AT5G45950 GDSL-like Lipase/Acylhydrolase... Lus10013956 2.0 0.9338
AT5G45950 GDSL-like Lipase/Acylhydrolase... Lus10005279 2.4 0.9310
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Lus10018351 3.5 0.9172
AT5G48385 FRIGIDA-like protein (.1) Lus10004132 4.2 0.8816
AT2G16850 PIP3B, PIP2;8 PLASMA MEMBRANE INTRINSIC PROT... Lus10027467 5.3 0.9101
AT2G20875 EPF1 epidermal patterning factor 1 ... Lus10018576 5.3 0.8893
AT3G15990 SULTR3;4 sulfate transporter 3;4 (.1) Lus10035896 5.5 0.8789
AT4G35470 PIRL4, DREB1C plant intracellular ras group-... Lus10035976 8.1 0.9027
AT1G09570 FHY2, HY8, FRE1... ELONGATED HYPOCOTYL 8, FAR RED... Lus10012151 8.8 0.8751
AT4G20160 unknown protein Lus10036249 9.9 0.8774

Lus10006610 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.