Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000510 [exp] 94 / 8e-26 ND 42 / 9e-05 Lus10041632 [exp] 89 / 5e-23 AT5G16080 182 / 1e-54 carboxyesterase 17 (.1) Lus10024087 [exp] 88 / 1e-22 AT5G16080 187 / 1e-56 carboxyesterase 17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G192650 [exp] 66 / 2e-14 AT5G16080 182 / 1e-54 carboxyesterase 17 (.1) Potri.001G032400 [exp] 64 / 4e-14 AT1G68620 185 / 9e-56 alpha/beta-Hydrolases superfamily protein (.1) Potri.003G192600 [exp] 62 / 4e-13 AT1G68620 173 / 2e-51 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G031500 [exp] 45 / 2e-07 AT1G68620 159 / 5e-46 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006615 pacid=23145319 polypeptide=Lus10006615 locus=Lus10006615.g ID=Lus10006615.BGIv1.0 annot-version=v1.0 ATGGAGCAGCCTGAATCACCGATGCCGACTATGGATATGATGGACAAGTTGTTGGGATTGGCGCAGTCGGTGGGGTTCATAAAGGACCACCCAATAACGT GTCTGATGGGGCCGATATGTGCTCCAGAGATGAAAGGGATAAGGCTGTCATCGTACGTGATGGTGGTAGCGGAGAAGGGTCTGGTGAAGGACACATAG
AA sequence Show only first row Show all	>Lus10006615 pacid=23145319 polypeptide=Lus10006615 locus=Lus10006615.g ID=Lus10006615.BGIv1.0 annot-version=v1.0 MEQPESPMPTMDMMDKLLGLAQSVGFIKDHPITCLMGPICAPEMKGIRLSSYVMVVAEKGLVKDT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006615 [exp]	0	1
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10033735 [exp]	7.8	0.8909
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10036296 [exp]	17.6	0.8889
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10003149 [exp]	21.2	0.8877
AT3G16910		AAE7, ACN1	ACETATE NON-UTILIZING 1, acyl-...		Lus10016870 [exp]	26.9	0.8838
AT4G31820		MAB4, ENP, NPY1	NAKED PINS IN YUC MUTANTS 1, M...		Lus10026256 [exp]	28.5	0.8661
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10013830 [exp]	29.8	0.8860
AT2G30140			UDP-Glycosyltransferase superf...		Lus10026394 [exp]	30.3	0.8844
AT5G39150			RmlC-like cupins superfamily p...		Lus10006543 [exp]	30.6	0.8581
AT1G29760			Putative adipose-regulatory pr...		Lus10033273 [exp]	38.2	0.8727
AT5G06740			Concanavalin A-like lectin pro...		Lus10016257 [exp]	40.1	0.8668

Compare expression of checked genes

Lus10006615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.