Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14723 99 / 4e-29 EPFL4, CLL2 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein AT3G22820 96 / 4e-28 EPFL5, CLL1 epidermal patterning factor like 5, CHALLAH-LIKE 1, allergen-related (.1) AT2G30370 81 / 2e-21 EPFL6, CHAL EPF1-like 6, CHALLAH, allergen-related (.1.2) AT3G13898 41 / 2e-06 unknown protein AT4G37810 41 / 3e-06 unknown protein AT1G80133 37 / 6e-05 unknown protein AT2G20875 36 / 0.0002 EPF1 epidermal patterning factor 1 (.1) AT5G10310 35 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041186 [exp] 105 / 1e-31 AT4G14723 106 / 5e-31 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Lus10021901 [exp] 100 / 2e-29 AT4G14723 104 / 2e-30 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Lus10024189 [exp] 75 / 1e-19 ND 107 / 4e-31 Lus10008387 [exp] 48 / 1e-08 AT3G13898 76 / 9e-19 unknown protein Lus10006016 [exp] 48 / 2e-08 AT3G13898 76 / 4e-17 unknown protein Lus10011591 [exp] 46 / 6e-08 AT4G37810 102 / 6e-29 unknown protein Lus10035922 [exp] 43 / 4e-07 AT5G10310 100 / 2e-28 unknown protein Lus10025740 [exp] 41 / 4e-06 AT5G10310 100 / 2e-28 unknown protein Lus10019254 [exp] 40 / 5e-06 AT4G37810 74 / 5e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G157300 [exp] 100 / 2e-29 AT4G14723 69 / 4e-16 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Potri.013G155500 [exp] 84 / 1e-22 AT2G30370 93 / 7e-25 EPF1-like 6, CHALLAH, allergen-related (.1.2) Potri.019G128200 [exp] 81 / 1e-21 AT2G30370 110 / 7e-32 EPF1-like 6, CHALLAH, allergen-related (.1.2) Potri.010G082200 [exp] 71 / 1e-17 AT4G14723 71 / 1e-16 epidermal patterning factor like 4, CHALLAH-LIKE 2, unknown protein Potri.003G042300 [exp] 48 / 1e-08 AT3G13898 80 / 4e-20 unknown protein Potri.007G095400 [exp] 44 / 3e-07 AT5G10310 105 / 2e-30 unknown protein Potri.005G073700 [exp] 43 / 5e-07 AT5G10310 102 / 7e-29 unknown protein Potri.002G112900 [exp] 42 / 1e-06 AT4G37810 90 / 9e-24 unknown protein Potri.018G130700 [exp] 41 / 3e-06 AT1G80133 62 / 1e-13 unknown protein Potri.013G136100 [exp] 35 / 0.0006 AT2G20875 118 / 2e-35 epidermal patterning factor 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006616 pacid=23145323 polypeptide=Lus10006616 locus=Lus10006616.g ID=Lus10006616.BGIv1.0 annot-version=v1.0 ATGGGCGGGCCAGGGTCATGGCCGCCGACGTGTAGATCCAAGTGCGGTGGTTGCGGGCCGTGCAAGGCGGTTCACGTACCGGTTCAACCAGGAGTAAGCT TCCCACTTGAGTACTACCCCGAAGCTTGGCGATGCAAGTGCGGGAACAAGCTCTTCATGCCTTGA
AA sequence Show only first row Show all	>Lus10006616 pacid=23145323 polypeptide=Lus10006616 locus=Lus10006616.g ID=Lus10006616.BGIv1.0 annot-version=v1.0 MGGPGSWPPTCRSKCGGCGPCKAVHVPVQPGVSFPLEYYPEAWRCKCGNKLFMP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10006616 [exp]	0	1
AT3G26744	bHLH	SCRM, ATICE1, I...	SCREAM, A. THALIANA INDUCER OF...		Lus10043199 [exp]	3.6	0.7806
AT3G58690			Protein kinase superfamily pro...		Lus10033606 [exp]	10.4	0.7759
AT2G11890			adenylate cyclases (.1.2)		Lus10024472 [exp]	11.7	0.7718
AT5G58170		GDPDL7, SVL5	Glycerophosphodiester phosphod...		Lus10019605 [exp]	11.8	0.7636
AT4G22360			SWIB complex BAF60b domain-con...		Lus10016581 [exp]	14.3	0.7699
AT3G26990			ENTH/VHS family protein (.1)		Lus10032013 [exp]	14.5	0.7689
AT5G19260		FAF3	FANTASTIC FOUR 3, Protein of u...		Lus10000655 [exp]	18.2	0.7402
AT1G29750		RKF1	receptor-like kinase in flower...		Lus10015239 [exp]	22.6	0.7312
AT2G40095			Alpha/beta hydrolase related p...		Lus10028294 [exp]	22.8	0.6883
AT1G18490			Protein of unknown function (D...		Lus10038962 [exp]	38.6	0.7308

Compare expression of checked genes

Lus10006616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.