Lus10006639 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14615 55 / 1e-11 unknown protein
AT1G52825 43 / 4e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039402 122 / 6e-34 AT1G76390 157 / 4e-39 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10041178 91 / 5e-26 AT4G14615 93 / 9e-27 unknown protein
Lus10021896 54 / 9e-11 AT4G14615 52 / 7e-10 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G079100 57 / 3e-12 AT4G14615 115 / 1e-35 unknown protein
Potri.008G160101 53 / 6e-11 AT4G14615 118 / 6e-37 unknown protein
PFAM info
Representative CDS sequence
>Lus10006639 pacid=23145308 polypeptide=Lus10006639 locus=Lus10006639.g ID=Lus10006639.BGIv1.0 annot-version=v1.0
ATGTCGAACATTGGAGTTTCGAATGTGGTTGTAGAGGTAGCGAAGTTCGCGGTGTATGTCGGCGTGCCAGTCTTTCTTATGAGCTTCGCCGCCGACGCCA
AGTTCCTCCACAAGCTAACCGGCAAGCGAGAGTACATAGTGTATCCAGCAGAGCTGGAAAGGCCTCCATCCACAGAAGAACTCAGAGACAATGCCCGGCA
ATTAGCTCGAGACAGGAAAGCTCAGCTGAGGTGA
AA sequence
>Lus10006639 pacid=23145308 polypeptide=Lus10006639 locus=Lus10006639.g ID=Lus10006639.BGIv1.0 annot-version=v1.0
MSNIGVSNVVVEVAKFAVYVGVPVFLMSFAADAKFLHKLTGKREYIVYPAELERPPSTEELRDNARQLARDRKAQLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14615 unknown protein Lus10006639 0 1
AT2G37240 Thioredoxin superfamily protei... Lus10014017 2.0 0.9516
AT5G42070 unknown protein Lus10023063 2.4 0.9555
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Lus10021923 4.2 0.9475
AT4G37000 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOR... Lus10009352 5.5 0.9467
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Lus10006188 6.0 0.9470
AT2G46100 Nuclear transport factor 2 (NT... Lus10007918 6.7 0.9357
AT4G09650 PDE332, ATPD PIGMENT DEFECTIVE 332, ATP syn... Lus10020508 7.9 0.9443
AT3G26070 Plastid-lipid associated prote... Lus10020982 7.9 0.9295
AT4G38225 unknown protein Lus10013843 8.0 0.9345
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Lus10041039 8.5 0.9467

Lus10006639 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.