Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45060 40 / 7e-05 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028293 [exp] 97 / 1e-26 AT4G22430 45 / 7e-06 F-box family protein (.1) Lus10025603 [exp] 84 / 3e-22 ND 36 / 0.006 Lus10007302 [exp] 71 / 1e-15 AT1G15680 49 / 4e-06 F-box family protein (.1) Lus10016522 [exp] 71 / 2e-15 AT2G37890 155 / 6e-42 Mitochondrial substrate carrier family protein (.1) Lus10002769 [exp] 70 / 2e-15 AT1G15680 64 / 2e-11 F-box family protein (.1) Lus10003349 [exp] 70 / 5e-15 AT1G46912 48 / 2e-05 F-box associated ubiquitination effector family protein (.1.2) Lus10040838 [exp] 66 / 7e-14 AT3G23950 57 / 2e-08 F-box family protein (.1) Lus10013987 [exp] 65 / 3e-13 AT3G23950 59 / 1e-08 F-box family protein (.1) Lus10007303 [exp] 64 / 4e-13 AT3G23950 45 / 6e-05 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G143300 [exp] 41 / 4e-05 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G142600 [exp] 41 / 5e-05 AT5G36930 535 / 5e-173 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006648 pacid=23158640 polypeptide=Lus10006648 locus=Lus10006648.g ID=Lus10006648.BGIv1.0 annot-version=v1.0 ATGTCTGATAGAGTCGTAGGAGAGACTCTTCATGTTTTCAATTGCTTCAATGACTTGGTTTTATGCGAGTTTTGGGATGCAGATTGCCACAATCAGAAGC CTATCAGATCGTACTTGATCTGCAATCTGTTTACTCAGAAGTGGAACGCTCTTCCTTTGGCACCTAGGTATAGTTGTTGGGATACCATACCAGTAGCAAG ACAATCTACATGTCCAGCTGATGAATTTGTGAACCTGTCTGATAATATTGTATCGTATTGCTACGAAAACCCTTTAGCATTAAGGGTTTTGGGAGATCCA TTGCACGAAAAGGATGAATGA
AA sequence Show only first row Show all	>Lus10006648 pacid=23158640 polypeptide=Lus10006648 locus=Lus10006648.g ID=Lus10006648.BGIv1.0 annot-version=v1.0 MSDRVVGETLHVFNCFNDLVLCEFWDADCHNQKPIRSYLICNLFTQKWNALPLAPRYSCWDTIPVARQSTCPADEFVNLSDNIVSYCYENPLALRVLGDP LHEKDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006648 [exp]	0	1
AT4G02210			unknown protein		Lus10023062 [exp]	18.8	0.7164
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10041605 [exp]	33.8	0.7292
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10001523 [exp]	33.8	0.7224
					Lus10014090 [exp]	45.3	0.7597
AT3G47340		AT-ASN1, DIN6, ...	DARK INDUCIBLE 6, ARABIDOPSIS ...		Lus10042281 [exp]	86.9	0.7367
					Lus10012672 [exp]	87.0	0.7280
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019030 [exp]	90.5	0.7300
AT5G42340		PUB15	Plant U-Box 15 (.1)		Lus10012260 [exp]	91.9	0.6934
AT5G06839	bZIP	TGA10, bZIP65	TGACG \(TGA\) motif-binding pr...		Lus10035499 [exp]	113.3	0.7040
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10007102 [exp]	126.4	0.6822

Compare expression of checked genes

Lus10006648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.