Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25430 40 / 0.0001 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) AT4G32285 39 / 0.0003 ENTH/ANTH/VHS superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019402 [exp] 47 / 4e-07 AT2G25430 580 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) Lus10001502 [exp] 42 / 2e-05 AT2G25430 914 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) Lus10002920 [exp] 42 / 2e-05 AT2G25430 909 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) Lus10043260 [exp] 39 / 0.0003 AT4G32285 506 / 2e-173 ENTH/ANTH/VHS superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G255000 [exp] 43 / 8e-06 AT2G25430 866 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) Potri.018G026900 [exp] 42 / 3e-05 AT2G25430 857 / 0.0 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related (.1) Potri.006G066900 [exp] 40 / 0.0001 AT4G32285 665 / 0.0 ENTH/ANTH/VHS superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006652 pacid=23158638 polypeptide=Lus10006652 locus=Lus10006652.g ID=Lus10006652.BGIv1.0 annot-version=v1.0 ATGGCGTTGATTACCTTCCGGAAGGCGATCAGAGCGGTAAAATACCAGACGAGTATAAGCCTCGCTAAGGTAGCCGGAAATATAGCGCCGAAGGTGGAGG GATTTCTTCTACAAACCATGGAGAATAAATTGGAGGAGATAGTTGCAGCAGCAGCAGCTGAGGTCAAGGAAGAGGAAGCAGAGATAACCGAGATCAAGGC TCAGCCTCAGTCATTGAAGGTGATGTGGCAAGATTCGGTGAACATGAGGGATGATAGACAAGGAAACAGATTGGCTTTGGCATTAGAAACTCAATTAGTT AGGCCACATATCGAACACTCTTTTAAAACAAAATAA
AA sequence Show only first row Show all	>Lus10006652 pacid=23158638 polypeptide=Lus10006652 locus=Lus10006652.g ID=Lus10006652.BGIv1.0 annot-version=v1.0 MALITFRKAIRAVKYQTSISLAKVAGNIAPKVEGFLLQTMENKLEEIVAAAAAEVKEEEAEITEIKAQPQSLKVMWQDSVNMRDDRQGNRLALALETQLV RPHIEHSFKTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006652 [exp]	0	1
					Lus10006591 [exp]	7.7	0.8350
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10019105 [exp]	23.6	0.8468
AT1G05460		SDE3	SILENCING DEFECTIVE, P-loop co...		Lus10017379 [exp]	26.5	0.7827
AT5G60370			unknown protein		Lus10023342 [exp]	36.0	0.8330
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10015489 [exp]	38.4	0.7900
AT1G70370		PG2	polygalacturonase 2 (.1.2)		Lus10034881 [exp]	53.7	0.8180
AT1G05490		CHR31	chromatin remodeling 31 (.1)		Lus10011033 [exp]	56.0	0.8142
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10019954 [exp]	58.6	0.7988
AT1G55790			Domain of unknown function (DU...		Lus10032901 [exp]	80.0	0.7983
AT3G04550			unknown protein		Lus10012941 [exp]	95.6	0.7331

Compare expression of checked genes

Lus10006652 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.