Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19780 97 / 6e-25 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040970 [exp] 174 / 6e-52 AT3G19780 500 / 5e-157 unknown protein Lus10013425 [exp] 166 / 6e-49 AT3G19780 743 / 0.0 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G070400 [exp] 114 / 4e-31 AT3G19780 770 / 0.0 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006653 pacid=23158630 polypeptide=Lus10006653 locus=Lus10006653.g ID=Lus10006653.BGIv1.0 annot-version=v1.0 ATGCATCCTTGCATCATCCTGATCGTCTCCGTCCCATGGTCCGGCGAATCGAGGTCCTTGATGAGGGAGATATCCGATTTAGTATCTGCCTGCTACGAGG GATTCGGCTCCCTCGAGTTGATGTATATGCATTGGAACAAGGAGAAGATGCTCGCTGATGCGATCGGTGCAGCCGGTGAGGGGAGAGTTACAGTTTTCTA TCTCCATCACTCTGTGCCTTACAAGTATCAAGGCAGGCGTCGAGCCATAGGTACTATATTGTACTCGATTAGTCCTTATTTGTCGCACGAGCCTGAATAG
AA sequence Show only first row Show all	>Lus10006653 pacid=23158630 polypeptide=Lus10006653 locus=Lus10006653.g ID=Lus10006653.BGIv1.0 annot-version=v1.0 MHPCIILIVSVPWSGESRSLMREISDLVSACYEGFGSLELMYMHWNKEKMLADAIGAAGEGRVTVFYLHHSVPYKYQGRRRAIGTILYSISPYLSHEPE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19780			unknown protein		Lus10006653 [exp]	0	1
AT1G76850		SEC5A	exocyst complex component sec5...		Lus10011294 [exp]	36.7	0.7454
AT4G21300			Tetratricopeptide repeat (TPR)...		Lus10028855 [exp]	57.9	0.7198
AT2G21050		LAX2	like AUXIN RESISTANT 2 (.1)		Lus10034488 [exp]	58.4	0.7322
AT1G18040		CDKD1;3, AT;CDC...	cyclin-dependent kinase D1;3 (...		Lus10017371 [exp]	77.2	0.7129
AT4G04940			transducin family protein / WD...		Lus10036625 [exp]	141.2	0.7067
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Lus10002178 [exp]	169.8	0.6968
AT3G07210			unknown protein		Lus10038194 [exp]	199.8	0.6902
AT5G42080		RSW9, DRP1A, AG...	RADIAL SWELLING 9, DYNAMIN-REL...		Lus10001820 [exp]	200.9	0.6797
AT5G19770		TUA3	tubulin alpha-3 (.1)		Lus10013765 [exp]	204.6	0.6890

Compare expression of checked genes

Lus10006653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.