Lus10006664 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45430 132 / 2e-37 AT-hook AHL22 AT-hook motif nuclear-localized protein 22 (.1)
AT4G12050 132 / 3e-37 AT-hook Predicted AT-hook DNA-binding family protein (.1)
AT4G22810 129 / 2e-36 AT-hook Predicted AT-hook DNA-binding family protein (.1)
AT2G42940 114 / 6e-31 AT-hook Predicted AT-hook DNA-binding family protein (.1)
AT4G17800 114 / 8e-31 AT-hook Predicted AT-hook DNA-binding family protein (.1)
AT3G60870 112 / 4e-30 AT-hook AHL18 AT-hook motif nuclear-localized protein 18 (.1)
AT2G35270 111 / 9e-30 AT-hook GIK, 2-ATH, AHL21 GIANT KILLER, Predicted AT-hook DNA-binding family protein (.1)
AT4G14465 110 / 2e-29 AT-hook AHL20 AT-hook motif nuclear-localized protein 20 (.1)
AT3G04570 102 / 4e-26 AT-hook AHL19 AT-hook motif nuclear-localized protein 19 (.1)
AT1G76500 96 / 6e-24 AT-hook SOB3, AHL29 SUPPRESSOR OF PHYB-4#3, AT-hook motif nuclear-localized protein 29, Predicted AT-hook DNA-binding family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020763 120 / 4e-33 AT2G42940 294 / 1e-100 Predicted AT-hook DNA-binding family protein (.1)
Lus10015862 113 / 3e-30 AT3G60870 227 / 1e-73 AT-hook motif nuclear-localized protein 18 (.1)
Lus10006577 112 / 4e-30 AT3G04570 270 / 1e-89 AT-hook motif nuclear-localized protein 19 (.1)
Lus10000519 112 / 1e-29 AT2G35270 205 / 1e-64 GIANT KILLER, Predicted AT-hook DNA-binding family protein (.1)
Lus10002711 112 / 1e-29 AT4G14465 211 / 1e-66 AT-hook motif nuclear-localized protein 20 (.1)
Lus10009301 110 / 6e-29 AT3G60870 223 / 4e-72 AT-hook motif nuclear-localized protein 18 (.1)
Lus10031460 103 / 1e-27 AT2G42940 214 / 1e-70 Predicted AT-hook DNA-binding family protein (.1)
Lus10031458 97 / 5e-25 AT2G42940 212 / 1e-69 Predicted AT-hook DNA-binding family protein (.1)
Lus10042551 93 / 1e-22 AT3G04570 202 / 4e-64 AT-hook motif nuclear-localized protein 19 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G116900 152 / 3e-45 AT4G22810 258 / 5e-85 Predicted AT-hook DNA-binding family protein (.1)
Potri.001G115200 152 / 4e-45 AT4G22810 254 / 1e-83 Predicted AT-hook DNA-binding family protein (.1)
Potri.002G149300 136 / 4e-39 AT2G45430 226 / 1e-72 AT-hook motif nuclear-localized protein 22 (.1)
Potri.014G070800 134 / 3e-38 AT2G45430 222 / 5e-71 AT-hook motif nuclear-localized protein 22 (.1)
Potri.008G164466 121 / 1e-34 AT4G14465 184 / 3e-58 AT-hook motif nuclear-localized protein 20 (.1)
Potri.010G074201 121 / 2e-33 AT4G14465 256 / 3e-85 AT-hook motif nuclear-localized protein 20 (.1)
Potri.005G202700 119 / 4e-33 AT2G42940 305 / 3e-105 Predicted AT-hook DNA-binding family protein (.1)
Potri.001G142800 117 / 4e-32 AT4G17800 300 / 6e-102 Predicted AT-hook DNA-binding family protein (.1)
Potri.002G059400 116 / 1e-31 AT2G42940 311 / 2e-107 Predicted AT-hook DNA-binding family protein (.1)
Potri.010G200100 116 / 3e-31 AT3G55560 209 / 2e-65 AT-hook motif nuclear-localized protein 15, AT-hook protein of GA feedback 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0615 ALDC PF03479 PCC Plants and Prokaryotes Conserved (PCC) domain
Representative CDS sequence
>Lus10006664 pacid=23152222 polypeptide=Lus10006664 locus=Lus10006664.g ID=Lus10006664.BGIv1.0 annot-version=v1.0
ATGGAGGTCGCCGACGGATGCGACATCGTTGATTCCGTCGCCACCTTCGCCCGACGCCGCCAGCGCGGCGTCTGCATCATGAGCGGGACCGGGACGGTCA
CCAACGTCACCCTCCGTCAACCAGCTTCTCCCGGAGCCGTGGTCACCCTCCACGGCCGATTCGAGATCTTATCCCTAGCGGGTTCCTTCCTCCCACCGCC
AGCTCCTCCTGCTGCCACCGGACTGACGATCTACCTCGCCGGAGGGCAAGGGCAAGTCGTAGGAGGAAGCGTGGTGGGCACGCTGACCGCTTCCGGTCCC
GTAGTCATCATGGCGGCTTCTTTCAGCAATGCGGCGTACGAGCGGCTGCCGTTGGAAGAGGAGGAGCCGCCACAGATGGCAGCGGCCGGTCAAGGCGGGA
TCGGCTCTCCGGGAGGAGGCGTGGGGTCCACCACCCCAAGTCAACAGCAGCAGCAGGTCATGGGTGGTAGTGGAACCGGGTCGGGGGACCCGAATGGAGC
TCCGCTTTTCCACGGTTTGCCTCCCAACTTGCTGAATTCCATCCAATTGCCCGCGGATGCTTACTGGGGCGGCGGAAACGGCAGCGGCGGAGGCGGCGGT
GGAGGACGTGCTCCTTACTGA
AA sequence
>Lus10006664 pacid=23152222 polypeptide=Lus10006664 locus=Lus10006664.g ID=Lus10006664.BGIv1.0 annot-version=v1.0
MEVADGCDIVDSVATFARRRQRGVCIMSGTGTVTNVTLRQPASPGAVVTLHGRFEILSLAGSFLPPPAPPAATGLTIYLAGGQGQVVGGSVVGTLTASGP
VVIMAASFSNAAYERLPLEEEEPPQMAAAGQGGIGSPGGGVGSTTPSQQQQQVMGGSGTGSGDPNGAPLFHGLPPNLLNSIQLPADAYWGGGNGSGGGGG
GGRAPY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45430 AT-hook AHL22 AT-hook motif nuclear-localize... Lus10006664 0 1
AT4G33590 unknown protein Lus10041131 1.4 0.9745
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10039806 1.7 0.9791
AT2G45430 AT-hook AHL22 AT-hook motif nuclear-localize... Lus10007007 3.5 0.9682
AT3G12120 FAD2 fatty acid desaturase 2 (.1.2) Lus10021045 3.7 0.9627
AT4G25320 AT-hook AT hook motif DNA-binding fami... Lus10031118 3.9 0.9715
AT3G55230 Disease resistance-responsive ... Lus10030318 5.0 0.9645
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10018575 5.5 0.9631
AT3G49950 GRAS GRAS family transcription fact... Lus10014852 5.8 0.9448
AT1G02460 Pectin lyase-like superfamily ... Lus10009994 6.6 0.9420
AT5G56040 Leucine-rich receptor-like pro... Lus10018094 6.6 0.9528

Lus10006664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.