Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46170 61 / 7e-12 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G17845 59 / 3e-11 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT3G55290 57 / 1e-10 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT1G63380 56 / 1e-10 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT3G55310 52 / 6e-09 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT3G01980 40 / 0.0001 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4) AT1G62610 0 / 1 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006698 [exp] 79 / 2e-18 AT1G63380 385 / 5e-136 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10012548 [exp] 42 / 4e-05 AT3G01980 337 / 2e-117 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4) Lus10041545 [exp] 41 / 9e-05 AT3G01980 346 / 6e-121 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4) Lus10007038 [exp] 0 / 1 AT1G63380 357 / 7e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10006699 [exp] 0 / 1 AT3G46170 404 / 2e-143 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10007039 [exp] 0 / 1 AT3G55290 369 / 3e-129 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G327800 [exp] 44 / 8e-06 AT3G01980 323 / 6e-112 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4) Potri.017G067332 [exp] 40 / 9e-05 AT3G01980 323 / 4e-112 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2), NAD(P)-binding Rossmann-fold superfamily protein (.3), NAD(P)-binding Rossmann-fold superfamily protein (.4) Potri.016G035200 [exp] 0 / 1 AT3G55290 385 / 8e-136 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006696 pacid=23152174 polypeptide=Lus10006696 locus=Lus10006696.g ID=Lus10006696.BGIv1.0 annot-version=v1.0 ATGCGTGATGCAGAGCTCGGAGGTTCCATAATCAATATTTCGTCGATCTTTGGTCTTAATCGTGGTTATACTCCTGGAGTTGTCGCTTATGCTTCTTCGA AGACTGGAATAAATGCCATGACGAAGGTGATGGCGCTGGAGTTGGGAGTGCACAAGATCAGAGTTAACTCTGTCACCTGGACTGTTCAAATCCGAGATAA CCGAAAGTCTCATGAAGAAGCCCGGTCTGGCTCGCTATGCTTAGAAGATGATCCCAATACAAGAAATTGGACCTGTAAACCCAACATTGACAGCAATCAT CCGATACCTCATCCACGAGTCGTCCCAGTATGTGACAGGCAATGTCTTTACCATCGACTCTGGGAACCACCTTAA
AA sequence Show only first row Show all	>Lus10006696 pacid=23152174 polypeptide=Lus10006696 locus=Lus10006696.g ID=Lus10006696.BGIv1.0 annot-version=v1.0 MRDAELGGSIINISSIFGLNRGYTPGVVAYASSKTGINAMTKVMALELGVHKIRVNSVTWTVQIRDNRKSHEEARSGSLCLEDDPNTRNWTCKPNIDSNH PIPHPRVVPVCDRQCLYHRLWEPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46170			NAD(P)-binding Rossmann-fold s...		Lus10006696 [exp]	0	1
AT3G05390			unknown protein		Lus10004494 [exp]	6.2	0.8854
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10014332 [exp]	6.5	0.8798
AT1G44760			Adenine nucleotide alpha hydro...		Lus10025644 [exp]	7.7	0.8682
AT5G20260			Exostosin family protein (.1)		Lus10005186 [exp]	10.4	0.8679
AT2G27550		ATC	centroradialis (.1)		Lus10019518 [exp]	10.5	0.7955
AT1G07290		GONST2	golgi nucleotide sugar transpo...		Lus10005865 [exp]	10.6	0.8674
					Lus10030676 [exp]	10.9	0.8676
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10001132 [exp]	11.0	0.8753
AT1G05030			Major facilitator superfamily ...		Lus10030010 [exp]	11.7	0.8788
AT5G46230			Protein of unknown function, D...		Lus10001891 [exp]	16.5	0.8317

Compare expression of checked genes

Lus10006696 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.