Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47710 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 119 / 3e-34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G49050 110 / 3e-31 unknown protein AT1G09740 103 / 1e-28 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 98 / 3e-26 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 93 / 4e-24 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G68300 85 / 2e-21 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 77 / 9e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G53990 57 / 9e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G01520 57 / 9e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007043 [exp] 321 / 2e-114 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006703 [exp] 268 / 6e-94 AT2G47710 169 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 112 / 8e-32 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 112 / 3e-31 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 108 / 1e-30 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 108 / 9e-28 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10009272 [exp] 97 / 6e-26 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 89 / 2e-22 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10025033 [exp] 80 / 5e-19 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G130100 [exp] 251 / 6e-87 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 229 / 3e-78 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 217 / 3e-73 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 191 / 2e-62 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 114 / 9e-33 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 108 / 1e-30 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 106 / 8e-30 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 105 / 6e-29 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 105 / 7e-29 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123400 [exp] 102 / 7e-28 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10006701 pacid=23152181 polypeptide=Lus10006701 locus=Lus10006701.g ID=Lus10006701.BGIv1.0 annot-version=v1.0 ATGGCGGCTGAGAAGCAAGTGATGGTGGTTGGGGTAGACGACAGCGAGCACAGCATGTACGCGCTGCAATGGACGCTCGACCATTTCTTCACTCCTTCGT CCGGCGACCTCTTCAAGCTCGTCGTCGTCCACTCCAAACCCACCCCTTCTTCCGTCGTCGGTCTCGCTGGCCCCGGCGCTGCTGAGGTTTTCCCGATCGT CGACTCCGACTTGAAGAAGATCGCCGCTAGGGTTCTTGACAAGACCAAGTCCATTTGCAGCAGTCATCAATCGGTGAAAGATGCGGTATATGAAGTAGTG GAAGGTGATGCCAGGAATGTACTGTGTGAAGCTGTAGAGAGGCACGGAGCTTCCATCCTGGTTGTGGGTAGCCATGGATATGGAACCCTCAAAAGGGCGG TTTTAGGCAGCGTGAGTGACTACTGTGCTCATCATGCTCACTGCACTGTCATGATTGTTAAGAAGCCTAAGGCCAAGCATTGA
AA sequence Show only first row Show all	>Lus10006701 pacid=23152181 polypeptide=Lus10006701 locus=Lus10006701.g ID=Lus10006701.BGIv1.0 annot-version=v1.0 MAAEKQVMVVGVDDSEHSMYALQWTLDHFFTPSSGDLFKLVVVHSKPTPSSVVGLAGPGAAEVFPIVDSDLKKIAARVLDKTKSICSSHQSVKDAVYEVV EGDARNVLCEAVERHGASILVVGSHGYGTLKRAVLGSVSDYCAHHAHCTVMIVKKPKAKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006701 [exp]	0	1
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10005107 [exp]	2.8	0.9866
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10010338 [exp]	2.8	0.9838
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006703 [exp]	3.3	0.9778
AT1G14540			Peroxidase superfamily protein...		Lus10009904 [exp]	3.5	0.9855
AT1G09090		ATRBOHB-BETA, A...	respiratory burst oxidase homo...		Lus10020644 [exp]	6.0	0.9853
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10003601 [exp]	7.1	0.9830
AT1G14540			Peroxidase superfamily protein...		Lus10000003 [exp]	7.1	0.9795
AT3G19615			unknown protein		Lus10031599 [exp]	7.3	0.9797
AT2G19130			S-locus lectin protein kinase ...		Lus10026391 [exp]	7.9	0.9718
AT2G41640			Glycosyltransferase family 61 ...		Lus10031057 [exp]	9.2	0.9752

Compare expression of checked genes

Lus10006701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.