Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47710 168 / 2e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G49050 110 / 1e-31 unknown protein AT3G11930 79 / 1e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 73 / 8e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 66 / 2e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 59 / 1e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 56 / 3e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G11360 54 / 3e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G54430 45 / 2e-06 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G27320 45 / 5e-06 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006701 [exp] 268 / 4e-94 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 265 / 7e-93 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 81 / 4e-19 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 76 / 3e-18 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 76 / 7e-17 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10034337 [exp] 72 / 8e-17 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 66 / 5e-14 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10015896 [exp] 62 / 1e-12 AT1G09740 185 / 3e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10038561 [exp] 55 / 8e-10 AT1G11360 224 / 7e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G130100 [exp] 201 / 3e-67 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 182 / 7e-60 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 173 / 2e-56 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 152 / 1e-47 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 82 / 1e-20 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 75 / 7e-18 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123200 [exp] 71 / 3e-16 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121800 [exp] 70 / 9e-16 AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 68 / 4e-15 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G196700 [exp] 67 / 1e-14 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10006703 pacid=23152217 polypeptide=Lus10006703 locus=Lus10006703.g ID=Lus10006703.BGIv1.0 annot-version=v1.0 ATGGCGGCTGAGAAGCAAGTGATGGTGGTTGGGGTAGACGACAGCGAGCACAGCATGTACGCGCTGCAATGGACGCTCGACCATTTCTTCACTCCTTCGT CCGGCGACCTCTTCAAGCTCGTCGTCGTCCACTCCAAACCCACCCCTTCTTCCGTCGTCGGTCTCGCTGGCCCCGGCGCTGCTGAGGTTTTCCCGATCGT CGACTCCGACTTGAAGAAGATCGCCGCTAGGGTTCTTGACAAGACCAAGTCCATTTGCAGCAGTCATCAATCGGTGAAAGATGCGGTATATGAAGTAGTG GAAGGTGATGCCAGGAATGTACTGTGTGAAGCTGTAGAGAGGCACGGAGCTTCCATCCTGGTTGTGGGTAGCCATGGATATGGAACCCTCAAAAGGTACC CGATCAATTTCTAA
AA sequence Show only first row Show all	>Lus10006703 pacid=23152217 polypeptide=Lus10006703 locus=Lus10006703.g ID=Lus10006703.BGIv1.0 annot-version=v1.0 MAAEKQVMVVGVDDSEHSMYALQWTLDHFFTPSSGDLFKLVVVHSKPTPSSVVGLAGPGAAEVFPIVDSDLKKIAARVLDKTKSICSSHQSVKDAVYEVV EGDARNVLCEAVERHGASILVVGSHGYGTLKRYPINF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006703 [exp]	0	1
AT2G47710			Adenine nucleotide alpha hydro...		Lus10007043 [exp]	1.4	0.9669
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006701 [exp]	3.3	0.9778
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015349 [exp]	6.0	0.9255
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Lus10011606 [exp]	11.7	0.9136
AT1G56300			Chaperone DnaJ-domain superfam...		Lus10029862 [exp]	15.4	0.9339
AT4G39720			VQ motif-containing protein (....		Lus10016814 [exp]	15.7	0.9273
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10010338 [exp]	15.9	0.9533
AT1G71695			Peroxidase superfamily protein...		Lus10028735 [exp]	18.5	0.9405
AT2G41640			Glycosyltransferase family 61 ...		Lus10031057 [exp]	19.6	0.9439
AT3G62550			Adenine nucleotide alpha hydro...		Lus10025033 [exp]	22.6	0.8930

Compare expression of checked genes

Lus10006703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.