Lus10006726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61330 56 / 2e-09 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT1G78840 45 / 1e-05 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT1G56400 44 / 4e-05 F-box family protein (.1.2)
AT3G58880 42 / 0.0001 F-box/RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011971 139 / 4e-38 AT1G61320 103 / 2e-23 FBD / Leucine Rich Repeat domains containing protein (.1)
Lus10034733 130 / 3e-35 AT1G61320 110 / 5e-26 FBD / Leucine Rich Repeat domains containing protein (.1)
Lus10018433 117 / 2e-30 AT1G61330 109 / 2e-25 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Lus10010664 115 / 1e-29 AT1G61320 125 / 6e-31 FBD / Leucine Rich Repeat domains containing protein (.1)
Lus10028334 59 / 1e-11 ND /
Lus10029682 54 / 8e-10 ND /
Lus10042721 56 / 6e-09 AT1G21750 684 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 5, PDI-like 1-1 (.1.2)
Lus10006866 45 / 2e-05 AT1G73040 194 / 5e-58 Mannose-binding lectin superfamily protein (.1)
Lus10011254 44 / 3e-05 AT1G61330 84 / 6e-17 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G042900 79 / 3e-17 AT1G61330 226 / 2e-68 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.004G034500 78 / 8e-17 AT1G61330 175 / 3e-49 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
Potri.006G244700 51 / 2e-07 AT5G41840 78 / 8e-15 F-box/RNI-like superfamily protein (.1)
Potri.006G248600 47 / 3e-06 AT5G41840 82 / 3e-16 F-box/RNI-like superfamily protein (.1)
Potri.014G039700 45 / 1e-05 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10006726 pacid=23163527 polypeptide=Lus10006726 locus=Lus10006726.g ID=Lus10006726.BGIv1.0 annot-version=v1.0
ATGAAGAGCCTCCACCTCCCGTACTTGCCAGACCACGTCGTAGAGCTGATCCTCGAACCCCTCAACATGCAACAGCTCGTCCCATTTTCCGCGGTAGCCA
AGAGGTTCAGGCACCGCTATAGACGTAGCCCGTACCTGAACTTCGGCCGGTCCTTTTTCAAACGTATTAAGAAAAATCGGGTTACTAATTGGTTGAATCA
TGAGGCTGAACAAGACCGGTATCGGTCGATAGTGGGCCAAATCATCGACAAGCACGACGGACCCAATATCCGATCCTTGAAGCTATCGTTCACCTCAGAA
GACAGCACAGATTCTTGGGCTTTGGTCTCGGGCTGGATCGACAAAGCGGCCCGTAAAGGAGTACAAGAGCTCCAATTGGATTTCCGCAGATGGTTCAAAT
TGACGGCTGAAGTTTTCAAAATTGAAACTCTGGAGATCCTACGGCTAACGTCGTGTAATCTCGTTTTGCCGCCTATTGGCGATTTTCGAATCACGGGGCT
ACGATTCCTCAAGGTCTGCTCCCTTAAATATGCGAGTTTCGGTGCCATCCTCATCAAGGCAATGTTGGAACCATGTTTGGAATTGGAGATGCTAGAGCCC
GTGAATTGA
AA sequence
>Lus10006726 pacid=23163527 polypeptide=Lus10006726 locus=Lus10006726.g ID=Lus10006726.BGIv1.0 annot-version=v1.0
MKSLHLPYLPDHVVELILEPLNMQQLVPFSAVAKRFRHRYRRSPYLNFGRSFFKRIKKNRVTNWLNHEAEQDRYRSIVGQIIDKHDGPNIRSLKLSFTSE
DSTDSWALVSGWIDKAARKGVQELQLDFRRWFKLTAEVFKIETLEILRLTSCNLVLPPIGDFRITGLRFLKVCSLKYASFGAILIKAMLEPCLELEMLEP
VN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10006726 0 1
Lus10000977 3.7 1.0000
Lus10000363 3.9 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10002747 4.6 1.0000
AT3G61150 HD HD-GL2-1, HDG1 HOMEODOMAIN-GLABRA2 1, homeodo... Lus10003300 5.9 1.0000
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10022134 6.7 1.0000
AT2G37890 Mitochondrial substrate carrie... Lus10006265 7.0 1.0000
AT1G20480 AMP-dependent synthetase and l... Lus10011621 7.5 1.0000
Lus10003285 7.7 1.0000
AT5G12060 Plant self-incompatibility pro... Lus10022829 8.4 1.0000
Lus10039545 8.4 1.0000

Lus10006726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.