Lus10006729 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18760 154 / 8e-49 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038301 271 / 6e-95 AT3G18760 154 / 7e-49 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G113200 163 / 2e-52 AT3G18760 186 / 1e-61 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01250 Ribosomal_S6 Ribosomal protein S6
Representative CDS sequence
>Lus10006729 pacid=23163563 polypeptide=Lus10006729 locus=Lus10006729.g ID=Lus10006729.BGIv1.0 annot-version=v1.0
ATGCCTCTTTACGACTGTGTGCTTCTATTGAAGCCTCAAGTGGACAGAACATCAATTATGAGTTTGATGACTCGAATAGGAAACCACGTTGCTACTAGAA
ATGGCGTCGTCACTGAAGTGAGATCATTTGGAACTATTCAACTTGGTTACGGCATCAAGAAACTTGATGGAAGATTTTTCCAGGGCCAACTGGTGCAGAT
GACGATGATGGCGACACCCAACATGAACAAGGAGCTTCATTACCTGAACAAGGAGGATCGGTTGCTGAGGTGGCTTCTGACTAAACACCGAAACACGGTC
TACTCTCATGACGATTACGATGAAGACACTGGGAAAAACGGACTGAAGAAATACTCGTACGGTGGAGCCATCTTAAACTTCCTCGAAAACGACGACGATG
ATGTGGACGAAGACAGTGAGGACGAAGATGATGCTGGTGGCCGTTATGATGATAGACCTCGACTATGA
AA sequence
>Lus10006729 pacid=23163563 polypeptide=Lus10006729 locus=Lus10006729.g ID=Lus10006729.BGIv1.0 annot-version=v1.0
MPLYDCVLLLKPQVDRTSIMSLMTRIGNHVATRNGVVTEVRSFGTIQLGYGIKKLDGRFFQGQLVQMTMMATPNMNKELHYLNKEDRLLRWLLTKHRNTV
YSHDDYDEDTGKNGLKKYSYGGAILNFLENDDDDVDEDSEDEDDAGGRYDDRPRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18760 Translation elongation factor... Lus10006729 0 1
AT2G20450 Ribosomal protein L14 (.1) Lus10008246 2.8 0.9193
AT5G50810 TIM8 translocase inner membrane sub... Lus10022450 5.8 0.9070
AT5G16060 Cytochrome c oxidase biogenesi... Lus10033547 6.0 0.8653
AT5G59180 NRPB7 DNA-directed RNA polymerase II... Lus10004986 6.9 0.8275
AT5G40080 Mitochondrial ribosomal protei... Lus10011032 7.9 0.8875
AT2G24830 C3HZnF zinc finger (CCCH-type) family... Lus10026901 8.6 0.8381
AT1G67785 unknown protein Lus10042077 9.2 0.8658
AT5G18790 Ribosomal protein L33 family p... Lus10012786 10.0 0.8791
AT2G01640 unknown protein Lus10002816 11.8 0.8625
AT5G56670 Ribosomal protein S30 family p... Lus10017473 13.5 0.8782

Lus10006729 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.