Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30920 50 / 5e-09 F-box family protein (.1) AT1G53550 44 / 1e-06 F-box family protein (.1) AT1G67130 44 / 1e-06 F-box family protein (.1) AT1G15015 43 / 1e-06 F-box family protein (.1) AT3G47150 44 / 2e-06 F-box and associated interaction domains-containing protein (.1) AT2G41473 41 / 2e-06 F-box family protein (.1) AT1G31090 43 / 3e-06 F-box family protein (.1) AT1G33020 42 / 4e-06 F-box and associated interaction domains-containing protein (.1) AT1G11270 42 / 4e-06 F-box and associated interaction domains-containing protein (.1.2.3) AT2G31470 42 / 7e-06 DOR DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013872 [exp] 51 / 3e-09 AT3G06240 101 / 2e-23 F-box family protein (.1) Lus10040338 [exp] 49 / 2e-08 AT4G12560 78 / 1e-15 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10042015 [exp] 44 / 4e-07 AT1G47790 48 / 7e-07 F-box and associated interaction domains-containing protein (.1) Lus10000190 [exp] 45 / 6e-07 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031478 [exp] 45 / 6e-07 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031480 [exp] 45 / 6e-07 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10039593 [exp] 44 / 8e-07 AT4G12560 75 / 9e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10025893 [exp] 44 / 9e-07 AT1G11270 49 / 7e-07 F-box and associated interaction domains-containing protein (.1.2.3) Lus10040463 [exp] 44 / 1e-06 AT4G12560 117 / 7e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G262900 [exp] 51 / 4e-09 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.011G037200 [exp] 49 / 2e-08 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1) Potri.008G199601 [exp] 46 / 3e-08 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.011G037312 [exp] 47 / 6e-08 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1) Potri.011G121200 [exp] 46 / 2e-07 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.017G012200 [exp] 45 / 3e-07 AT4G12560 86 / 4e-18 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G013000 [exp] 44 / 7e-07 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.017G058900 [exp] 44 / 7e-07 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.001G318300 [exp] 44 / 8e-07 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.001G458400 [exp] 44 / 9e-07 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10006734 pacid=23163584 polypeptide=Lus10006734 locus=Lus10006734.g ID=Lus10006734.BGIv1.0 annot-version=v1.0 ATGTCCGATTACATTCCGGCCGATCTCATCACCGGAATCCTCCCCCAGCTGCCGGTTGCGGCACTTCTGCGATGCCGTTGCGTCTCCAGAGCTTGGCGGG CACTGATCGACAGCTCTAGGTTCAGCCAGCTCCAAATGGACTACTCACAGCGGCGACTACGTCGTCTCCGAATACGTGAACGGCCTCCAACGCGGAATCG GAAGTGA
AA sequence Show only first row Show all	>Lus10006734 pacid=23163584 polypeptide=Lus10006734 locus=Lus10006734.g ID=Lus10006734.BGIv1.0 annot-version=v1.0 MSDYIPADLITGILPQLPVAALLRCRCVSRAWRALIDSSRFSQLQMDYSQRRLRRLRIRERPPTRNRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30920			F-box family protein (.1)		Lus10006734 [exp]	0	1
AT3G08030			Protein of unknown function, D...		Lus10029502 [exp]	3.0	0.9819
					Lus10029164 [exp]	4.0	0.8821
AT3G18170			Glycosyltransferase family 61 ...		Lus10032454 [exp]	4.2	0.9819
AT4G37360		CYP81D2	"cytochrome P450, family 81, s...		Lus10018719 [exp]	4.4	0.8571
AT2G24370			Protein kinase protein with ad...		Lus10027593 [exp]	5.2	0.9819
					Lus10004437 [exp]	6.0	0.9819
AT4G14368			Regulator of chromosome conden...		Lus10038991 [exp]	6.5	0.8301
AT5G02910			F-box/RNI-like superfamily pro...		Lus10000727 [exp]	6.7	0.9819
					Lus10039674 [exp]	7.3	0.9819
					Lus10021739 [exp]	7.9	0.9819

Compare expression of checked genes

Lus10006734 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.