Lus10006743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49710 179 / 2e-53 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 171 / 1e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 159 / 6e-46 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G02010 158 / 1e-45 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G39680 155 / 1e-44 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 154 / 3e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G23330 154 / 3e-44 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 151 / 3e-43 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G57430 151 / 5e-43 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G08820 150 / 8e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020081 305 / 4e-101 AT3G49710 886 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10040577 167 / 3e-51 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035157 149 / 1e-46 AT3G26782 221 / 2e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035164 159 / 1e-45 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031994 157 / 2e-45 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020588 148 / 1e-44 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022629 154 / 2e-44 AT2G41080 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001220 154 / 3e-44 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004892 154 / 7e-44 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G012500 215 / 1e-66 AT3G49710 995 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G155100 174 / 3e-51 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 166 / 1e-48 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G027800 159 / 4e-46 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G075000 157 / 1e-45 AT2G41080 755 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G237100 157 / 2e-45 AT3G02010 967 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 155 / 5e-45 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G129100 157 / 6e-45 AT5G09950 1287 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G136200 155 / 7e-45 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.001G354400 155 / 7e-45 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10006743 pacid=23163574 polypeptide=Lus10006743 locus=Lus10006743.g ID=Lus10006743.BGIv1.0 annot-version=v1.0
ATGCGAGAGCGAGGAGTGAAAAAGCTTCCGGGATGCAGTTGGCTCGAGTTACAGAAGAAGGTGCATGTTTTCATAGCAGAAGACAATTCACATCCGATGA
TGAACCCGATTCGCGACTATGTGAACTGGATAATGATGAAGATCAAACAAGCTGGATATGTGCCGGATCTGAGATGTGCATTGGTTAAAGATGACGATGA
GAAGACACGGGAAGCGAATAAAGAGATGAGTTTAAGGCATCATAGTGAGAAACTGGCCGTTGCATTCGGACTGATGTCGGCTAAAGACGGGGTGCCTATA
ACTGTGATGAAGAACTTAAGGATATGTGGGGATTGTCACAATGCAATGAAGTACATTTCTGCTGTTAGTTGTAGGAAAATTACTGTGAGGGATGCCAATA
GGTTTCATTGTTTTGAACAAGGCCATTGTTCTTGTGGAGACTACTGGTGA
AA sequence
>Lus10006743 pacid=23163574 polypeptide=Lus10006743 locus=Lus10006743.g ID=Lus10006743.BGIv1.0 annot-version=v1.0
MRERGVKKLPGCSWLELQKKVHVFIAEDNSHPMMNPIRDYVNWIMMKIKQAGYVPDLRCALVKDDDEKTREANKEMSLRHHSEKLAVAFGLMSAKDGVPI
TVMKNLRICGDCHNAMKYISAVSCRKITVRDANRFHCFEQGHCSCGDYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49710 Pentatricopeptide repeat (PPR)... Lus10006743 0 1
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10028249 3.9 0.8062
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10002561 5.5 0.7767
AT4G02750 Tetratricopeptide repeat (TPR)... Lus10027365 5.7 0.7967
AT5G56440 F-box/RNI-like/FBD-like domain... Lus10023425 7.7 0.7865
AT3G11591 unknown protein Lus10032336 10.4 0.7088
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025412 11.7 0.7902
AT2G36730 Pentatricopeptide repeat (PPR)... Lus10004373 13.2 0.7811
AT1G17120 CAT8 cationic amino acid transporte... Lus10013705 15.1 0.6974
AT5G64350 FKP12, ATFKBP12... ARABIDOPSIS THALIANA FK506-BIN... Lus10016586 15.7 0.7615
AT3G63390 unknown protein Lus10024829 17.7 0.7349

Lus10006743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.