Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10010 115 / 8e-32 unknown protein AT5G64910 69 / 8e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006823 [exp] 131 / 3e-38 AT5G10010 476 / 1e-168 unknown protein Lus10005778 [exp] 123 / 5e-35 AT5G10010 466 / 5e-164 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G083700 [exp] 117 / 4e-33 AT5G10010 363 / 5e-124 unknown protein Potri.007G082000 [exp] 117 / 6e-33 AT5G10010 388 / 8e-134 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006744 pacid=23163545 polypeptide=Lus10006744 locus=Lus10006744.g ID=Lus10006744.BGIv1.0 annot-version=v1.0 ATGGAACCTGCTATTAATCTGAGAGTTGACGAACAGCCAGCGAGACTCAAGGAATCGTTTGAAGGAGGAGGTGTTCTTCACGAAAAGAAAGTTTATCTCT TTGGCCAGGCTGAACCTCAATTGGTCCATTACCAAGGTGATTATAAGCTAATTAATGTACCTGCAATTATTGCCATTGATTTACCTTTCCCATCATCGGA TAAGATGGGGATTGCTTCCGTTCAAAGAGAAGAAGAAATAATTCCTATGGAGCAAATGGATATAGACTGGGTGCCATATGGACTGCGATCTCAAGTCGTC ATCTTGACCTGTACCCAGACCACGTTAGCCTTATCGCATATGTAA
AA sequence Show only first row Show all	>Lus10006744 pacid=23163545 polypeptide=Lus10006744 locus=Lus10006744.g ID=Lus10006744.BGIv1.0 annot-version=v1.0 MEPAINLRVDEQPARLKESFEGGGVLHEKKVYLFGQAEPQLVHYQGDYKLINVPAIIAIDLPFPSSDKMGIASVQREEEIIPMEQMDIDWVPYGLRSQVV ILTCTQTTLALSHM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10010			unknown protein		Lus10006744 [exp]	0	1
AT2G20570	GARP	ATGLK1, GLK1, G...	ARABIDOPSIS GOLDEN2-LIKE 1, GB...		Lus10018649 [exp]	3.5	0.8099
AT3G57170			N-acetylglucosaminyl transfera...		Lus10003248 [exp]	4.0	0.8302
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Lus10040108 [exp]	4.9	0.8215
AT2G29990		NDA2	alternative NAD(P)H dehydrogen...		Lus10018249 [exp]	4.9	0.8500
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10022663 [exp]	11.0	0.7609
AT1G27180			disease resistance protein (TI...		Lus10040576 [exp]	12.5	0.7650
AT5G36930			Disease resistance protein (TI...		Lus10011240 [exp]	13.1	0.7233
AT2G20570	GARP	ATGLK1, GLK1, G...	ARABIDOPSIS GOLDEN2-LIKE 1, GB...		Lus10039883 [exp]	16.3	0.7757
					Lus10034884 [exp]	16.4	0.7583
AT1G27180			disease resistance protein (TI...		Lus10023093 [exp]	18.7	0.7480

Compare expression of checked genes

Lus10006744 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.