Lus10006748 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27270 296 / 2e-103 Quinone reductase family protein (.1)
AT5G54500 295 / 1e-102 FQR1 flavodoxin-like quinone reductase 1 (.1.2)
AT4G36750 249 / 2e-83 Quinone reductase family protein (.1)
AT5G58800 235 / 6e-79 Quinone reductase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020076 360 / 3e-128 AT4G27270 314 / 2e-110 Quinone reductase family protein (.1)
Lus10018401 342 / 3e-121 AT4G27270 342 / 3e-121 Quinone reductase family protein (.1)
Lus10007612 342 / 1e-120 AT4G27270 329 / 1e-115 Quinone reductase family protein (.1)
Lus10041718 250 / 6e-84 AT4G36750 357 / 3e-125 Quinone reductase family protein (.1)
Lus10026035 242 / 4e-81 AT4G36750 371 / 4e-131 Quinone reductase family protein (.1)
Lus10014325 242 / 5e-81 AT4G36750 370 / 2e-130 Quinone reductase family protein (.1)
Lus10005862 228 / 2e-76 AT5G58800 290 / 5e-101 Quinone reductase family protein (.1.2)
Lus10040486 205 / 9e-67 AT4G36750 291 / 6e-100 Quinone reductase family protein (.1)
Lus10024032 174 / 1e-55 AT4G36750 248 / 5e-84 Quinone reductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G028900 303 / 7e-106 AT4G27270 352 / 2e-125 Quinone reductase family protein (.1)
Potri.011G129400 302 / 1e-105 AT4G27270 342 / 2e-121 Quinone reductase family protein (.1)
Potri.011G033100 302 / 2e-105 AT4G27270 352 / 1e-125 Quinone reductase family protein (.1)
Potri.001G410700 301 / 3e-105 AT4G27270 345 / 1e-122 Quinone reductase family protein (.1)
Potri.009G044400 247 / 6e-84 AT5G58800 322 / 3e-113 Quinone reductase family protein (.1.2)
Potri.005G126200 242 / 5e-81 AT4G36750 361 / 4e-127 Quinone reductase family protein (.1)
Potri.007G029600 241 / 2e-80 AT4G36750 362 / 3e-127 Quinone reductase family protein (.1)
Potri.004G151100 222 / 5e-73 AT4G36750 311 / 4e-107 Quinone reductase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0042 Flavoprotein PF03358 FMN_red NADPH-dependent FMN reductase
Representative CDS sequence
>Lus10006748 pacid=23163571 polypeptide=Lus10006748 locus=Lus10006748.g ID=Lus10006748.BGIv1.0 annot-version=v1.0
ATGAACTGCTGCTGGCCTAATGTCTTGTGCAGTTACTATTCTATGTATGGACATGTTGAGCAATTAGCTGAAGAGATTCAGAAAGGAGCTTCAACTGTGG
ATGGTGTTGAAGTTAAACTATGGCAGGTAGCAGAGACACTGCCGGAAGAGGTTCTTGGCAAAATGGGTGCGCCAGCAAAGAAGAGTGAAGTGCCAATCAT
CACTGCCAGTGAGCTTGCTGAAGCTGATGGCATTCTTTTCGGGTTCCCTACTCGGTTCGGGATGATGGCTGCTCAATTCAAGGCGTTCATGGACTCAACT
GGAGGCCTTTGGAAGACACAGGCGCTTCAAGGGAAGCCTGCTGGACTCTTCTACTCCACTGGCTCTCAAGGTGGTGGCCAGGAGACCACCCCGTTGACAG
CGATCACGCAGCTAGTTCACCACGGAATGTTGTTCGTGCCGGTGGGATACACATTCGGAGGAGGGATGTTCGAGATGGAAGAGGTGAAAGGGGGGAGTCC
ATATGGTGCAGGGACATTTGCAGGAGATGGATCCAGGCAGCCTAGTGAGCTTGAGTTGGGTTTGGCTCATCACCAGGGCAAGCATTTTGCTGCCATCGCC
AAGAAATTGAAGGGTTCTGAATCTGATGCTTGA
AA sequence
>Lus10006748 pacid=23163571 polypeptide=Lus10006748 locus=Lus10006748.g ID=Lus10006748.BGIv1.0 annot-version=v1.0
MNCCWPNVLCSYYSMYGHVEQLAEEIQKGASTVDGVEVKLWQVAETLPEEVLGKMGAPAKKSEVPIITASELAEADGILFGFPTRFGMMAAQFKAFMDST
GGLWKTQALQGKPAGLFYSTGSQGGGQETTPLTAITQLVHHGMLFVPVGYTFGGGMFEMEEVKGGSPYGAGTFAGDGSRQPSELELGLAHHQGKHFAAIA
KKLKGSESDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27270 Quinone reductase family prote... Lus10006748 0 1
AT1G18980 RmlC-like cupins superfamily p... Lus10036658 2.0 0.9177
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Lus10013589 4.8 0.9197
AT4G36990 HSF AT-HSFB1, ATHSF... ARABIDOPSIS THALIANA HEAT SHOC... Lus10018488 6.0 0.8748
AT1G28480 roxy19, GRX480 Thioredoxin superfamily protei... Lus10018631 11.0 0.8886
AT4G16820 PLA-I{beta]2 phospholipase A I beta 2, alph... Lus10010997 12.5 0.8553
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Lus10028157 17.4 0.8620
AT1G63290 Aldolase-type TIM barrel famil... Lus10032052 22.0 0.8602
AT4G20820 FAD-binding Berberine family p... Lus10032943 24.0 0.8773
AT3G09520 ATEXO70H4 exocyst subunit exo70 family p... Lus10025291 25.2 0.8957
AT4G34050 CCoAOMT1 caffeoyl coenzyme A O-methyltr... Lus10014074 26.1 0.8595

Lus10006748 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.