Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11570 130 / 2e-40 NTL NTF2-like (.1.2) AT1G27970 115 / 1e-34 NTF2B nuclear transport factor 2B (.1.2) AT1G27310 114 / 6e-34 NTF2A nuclear transport factor 2A (.1) AT5G48650 40 / 0.0002 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020061 [exp] 196 / 2e-66 AT1G11570 171 / 3e-56 NTF2-like (.1.2) Lus10035202 [exp] 115 / 1e-34 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1) Lus10032033 [exp] 114 / 7e-34 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2) Lus10015772 [exp] 113 / 1e-33 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1) Lus10037033 [exp] 113 / 2e-33 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2) Lus10036918 [exp] 39 / 0.0003 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10026668 [exp] 39 / 0.0003 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G025500 [exp] 150 / 7e-48 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.003G170800 [exp] 114 / 4e-34 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2) Potri.001G057500 [exp] 113 / 7e-34 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2) Potri.017G094600 [exp] 47 / 3e-07 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 39 / 0.0003 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10006762 pacid=23163585 polypeptide=Lus10006762 locus=Lus10006762.g ID=Lus10006762.BGIv1.0 annot-version=v1.0 ATGGAAGAGCAAGTGGAGATGGTTGGGAAGGCGTTTGTGGATCACTACTACCATCTATTCGACACGAGTCGAACTTCCCTTGCGTCCCTCTACCAGTCAT CCGCCATGCTTACTTTCGAAGGCCAGAAGATGGTCGGCGTGGACCAAATCTCGGCCAGGCTCAATGGGTTGCCTTTTGATCATTGTAAGCATTTAGTTAG CAGTGTTGACTCCCAGGCTGCTCCGCTGGCCACCGGAGGAGGCATTGTTATCTTCGTCAGTGGGTGCCTGCACTTGCTTGGTGAAGAACATCCTCTCCGA TTCAGCCAGGATCTGAAACCATCCTGA
AA sequence Show only first row Show all	>Lus10006762 pacid=23163585 polypeptide=Lus10006762 locus=Lus10006762.g ID=Lus10006762.BGIv1.0 annot-version=v1.0 MEEQVEMVGKAFVDHYYHLFDTSRTSLASLYQSSAMLTFEGQKMVGVDQISARLNGLPFDHCKHLVSSVDSQAAPLATGGGIVIFVSGCLHLLGEEHPLR FSQDLKPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11570		NTL	NTF2-like (.1.2)		Lus10006762 [exp]	0	1
					Lus10032767 [exp]	5.0	0.9202
					Lus10035048 [exp]	9.5	0.9109
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10034869 [exp]	13.2	0.8949
					Lus10035062 [exp]	14.1	0.9035
					Lus10031014 [exp]	16.6	0.8816
AT5G36930			Disease resistance protein (TI...		Lus10007852 [exp]	17.4	0.8971
					Lus10008289 [exp]	17.5	0.8961
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10033212 [exp]	17.9	0.8970
AT3G18670			Ankyrin repeat family protein ...		Lus10035567 [exp]	20.4	0.8858
AT4G22370			unknown protein		Lus10003793 [exp]	25.5	0.8835

Compare expression of checked genes

Lus10006762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.