Lus10006763 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04900 79 / 4e-19 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT4G28556 72 / 5e-16 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT1G04450 72 / 1e-15 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT2G33460 71 / 2e-15 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT4G21745 68 / 9e-15 PAK-box/P21-Rho-binding family protein (.1)
AT2G20430 67 / 4e-14 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT3G23380 66 / 1e-13 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT1G03982 53 / 4e-09 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 52 / 7e-09 PAK-box/P21-Rho-binding family protein (.1)
AT1G27380 42 / 2e-05 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007648 136 / 6e-41 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10018362 136 / 6e-41 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10020060 115 / 3e-32 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10011805 75 / 1e-16 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10003625 69 / 5e-15 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10008243 68 / 2e-14 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10021168 62 / 2e-11 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10021974 39 / 0.0005 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G025300 108 / 2e-30 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.004G020650 103 / 2e-28 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.008G168900 86 / 1e-20 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.010G069500 85 / 5e-20 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G035500 79 / 5e-18 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.005G227500 78 / 7e-18 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G233400 55 / 1e-09 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 46 / 2e-06 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.013G086600 39 / 0.0004 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10006763 pacid=23163528 polypeptide=Lus10006763 locus=Lus10006763.g ID=Lus10006763.BGIv1.0 annot-version=v1.0
ATGGGTACCAACAAGATTAAAGGGATCTACAGGGGATTCAAGTACATCATCCAAATCTTTGTTGTGAAGGAGAGAGAATTAGAAATTGGGCTGCCAACCG
ATGTAAAGCATGTCGCTCACATCGGCTGTGATGGTACTGCAGGAAATCCACCCAGCTGGATGAGTGGACCTAAGATATCTCCAGAACTTTCATCATCGGT
AAAAGCTTATGGTGGGAGTCCTAATAATAATGGAATCCCTAGGGACTCCAGTACTAATTCAATGTTTTTCACTCCCAGGGCCTCCCCAGATTTGAACAGT
TCATCAACGGGATATCATCATTTACCTGGAACAGCTTGCACCTTGGAAGATGCAATTCGGAGATCTGATAACCCATCGAGCAAACCAAAGAAACAGAAGA
GGAAGAAGAAGACAAGATCATCTGCTTTAAAGGGTTCATCTTCCTTGTCCAAGAACTTACGATCGTCACCAAATACTAAATTCCATGAACTGGAGCCAAC
TGTGGCTATACTAGCCTAG
AA sequence
>Lus10006763 pacid=23163528 polypeptide=Lus10006763 locus=Lus10006763.g ID=Lus10006763.BGIv1.0 annot-version=v1.0
MGTNKIKGIYRGFKYIIQIFVVKERELEIGLPTDVKHVAHIGCDGTAGNPPSWMSGPKISPELSSSVKAYGGSPNNNGIPRDSSTNSMFFTPRASPDLNS
SSTGYHHLPGTACTLEDAIRRSDNPSSKPKKQKRKKKTRSSALKGSSSLSKNLRSSPNTKFHELEPTVAILA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10006763 0 1
AT2G41110 ACAM-2, ATCAL5,... calmodulin 2 (.1.2) Lus10021487 3.2 0.9343
AT1G51990 O-methyltransferase family pro... Lus10002668 6.5 0.9074
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10020190 8.4 0.9299
AT2G23970 Class I glutamine amidotransfe... Lus10019964 11.9 0.9180
AT4G16400 unknown protein Lus10038791 12.8 0.9167
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10020191 13.4 0.9147
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10028432 13.6 0.9154
AT1G56260 MDO1 MERISTEM DISORGANIZATION 1, un... Lus10020669 14.0 0.9082
AT5G05365 Heavy metal transport/detoxifi... Lus10040965 14.7 0.9111
AT1G69880 ATH8 thioredoxin H-type 8 (.1) Lus10036698 15.0 0.8929

Lus10006763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.