Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61930 111 / 3e-32 Protein of unknown function, DUF584 (.1) AT1G11700 109 / 2e-31 Protein of unknown function, DUF584 (.1) AT4G21930 102 / 8e-29 Protein of unknown function, DUF584 (.1) AT4G21970 79 / 3e-20 Protein of unknown function, DUF584 (.1) AT4G04630 77 / 2e-19 Protein of unknown function, DUF584 (.1) AT3G45210 73 / 7e-18 Protein of unknown function, DUF584 (.1) AT2G28400 71 / 8e-17 Protein of unknown function, DUF584 (.1) AT5G03230 69 / 3e-16 Protein of unknown function, DUF584 (.1) AT5G60680 67 / 2e-15 Protein of unknown function, DUF584 (.1) AT3G15040 62 / 4e-13 Protein of unknown function, DUF584 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020047 [exp] 179 / 2e-59 AT1G61930 124 / 8e-36 Protein of unknown function, DUF584 (.1) Lus10002073 [exp] 121 / 6e-36 AT1G61930 156 / 5e-48 Protein of unknown function, DUF584 (.1) Lus10021474 [exp] 81 / 2e-20 AT5G60680 138 / 6e-42 Protein of unknown function, DUF584 (.1) Lus10019936 [exp] 81 / 2e-20 AT5G03230 99 / 1e-26 Protein of unknown function, DUF584 (.1) Lus10041309 [exp] 80 / 3e-20 AT5G60680 137 / 5e-42 Protein of unknown function, DUF584 (.1) Lus10026507 [exp] 79 / 8e-19 AT5G03230 97 / 1e-24 Protein of unknown function, DUF584 (.1) Lus10006781 [exp] 75 / 4e-18 AT4G21970 128 / 6e-38 Protein of unknown function, DUF584 (.1) Lus10020043 [exp] 75 / 4e-18 AT4G21970 127 / 1e-37 Protein of unknown function, DUF584 (.1) Lus10004207 [exp] 70 / 5e-16 AT3G15040 110 / 1e-29 Protein of unknown function, DUF584 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G015700 [exp] 136 / 5e-42 AT1G11700 151 / 5e-46 Protein of unknown function, DUF584 (.1) Potri.011G003300 [exp] 135 / 2e-41 AT1G11700 161 / 6e-50 Protein of unknown function, DUF584 (.1) Potri.011G004100 [exp] 81 / 1e-20 AT4G04630 125 / 1e-36 Protein of unknown function, DUF584 (.1) Potri.009G014100 [exp] 77 / 4e-19 AT3G45210 124 / 2e-36 Protein of unknown function, DUF584 (.1) Potri.004G014000 [exp] 75 / 3e-18 AT4G04630 124 / 4e-36 Protein of unknown function, DUF584 (.1) Potri.016G089900 [exp] 74 / 6e-18 AT5G03230 115 / 6e-33 Protein of unknown function, DUF584 (.1) Potri.004G211100 [exp] 74 / 6e-18 AT5G60680 120 / 1e-34 Protein of unknown function, DUF584 (.1) Potri.016G076300 [exp] 70 / 4e-16 AT3G15040 90 / 9e-22 Protein of unknown function, DUF584 (.1) Potri.006G127900 [exp] 69 / 8e-16 AT5G03230 122 / 1e-35 Protein of unknown function, DUF584 (.1) Potri.011G076900 [exp] 49 / 9e-09 AT1G29640 90 / 4e-24 Protein of unknown function, DUF584 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04520 [flax] [poplar] Senescence_reg Senescence regulator
Representative CDS sequence Show only first row Show all	>Lus10006775 pacid=23163534 polypeptide=Lus10006775 locus=Lus10006775.g ID=Lus10006775.BGIv1.0 annot-version=v1.0 ATGACCGCGGCGTCGTCGGCTCCGGTGAACGTGCCGGATTGGGGGAAGATTCTGCGGGTGAGGTCCGCGGAGTCGATGAATGAGATGAGCGACTACGACG GAGATGATTCGGAAGAGATGATGGTCCCGCCGCATGAGTACCTAGCGCGTGAGTACGCACGGAGAAGGAAAATGGAGGGGGCGTCGGTGGTTGAAGGGGT TGGCAGGACGTTGAAGGGGCGTGACATGAGGCGCGTGAGGGACGCTGTGTGGAGCCAAACGGGGTTTTACGGCTGA
AA sequence Show only first row Show all	>Lus10006775 pacid=23163534 polypeptide=Lus10006775 locus=Lus10006775.g ID=Lus10006775.BGIv1.0 annot-version=v1.0 MTAASSAPVNVPDWGKILRVRSAESMNEMSDYDGDDSEEMMVPPHEYLAREYARRRKMEGASVVEGVGRTLKGRDMRRVRDAVWSQTGFYG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61930			Protein of unknown function, D...		Lus10006775 [exp]	0	1
AT2G21970		SEP2	stress enhanced protein 2 (.1)		Lus10036629 [exp]	3.5	0.8899
AT1G61930			Protein of unknown function, D...		Lus10020047 [exp]	5.3	0.8925
AT2G35940	HD	BLH1, EDA29	embryo sac development arrest ...		Lus10021270 [exp]	6.3	0.8689
AT5G57040			Lactoylglutathione lyase / gly...		Lus10017158 [exp]	14.0	0.8789
AT4G38225			unknown protein		Lus10013843 [exp]	15.4	0.8708
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10004703 [exp]	16.2	0.8386
AT3G48090		ATEDS1, EDS1	enhanced disease susceptibilit...		Lus10042937 [exp]	16.9	0.8291
AT5G61820			unknown protein		Lus10042158 [exp]	17.2	0.8152
AT2G35810			unknown protein		Lus10023491 [exp]	18.8	0.8610
AT4G38225			unknown protein		Lus10026560 [exp]	19.3	0.8677

Compare expression of checked genes

Lus10006775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.