Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63920 42 / 2e-05 TOP3A, AtTOP3alpha topoisomerase 3alpha (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003766 [exp] 141 / 2e-44 ND 36 / 0.004 Lus10032975 [exp] 134 / 4e-42 ND 40 / 1e-04 Lus10005485 [exp] 89 / 2e-24 ND 34 / 0.007 Lus10039338 [exp] 79 / 3e-20 ND / Lus10039973 [exp] 69 / 2e-16 ND / Lus10037411 [exp] 61 / 6e-12 AT2G28450 874 / 0.0 zinc finger (CCCH-type) family protein (.1), zinc finger (CCCH-type) family protein (.2) Lus10040117 [exp] 53 / 3e-09 AT3G60190 907 / 0.0 ENHANCED DISEASE RESISTANCE 3, DYNAMIN-RELATED PROTEIN 1E, DYNAMIN-LIKE PROTEIN 2, ARABIDOPSIS DYNAMIN-LIKE 4, DYNAMIN-like 1E (.1) Lus10011688 [exp] 47 / 3e-07 ND / Lus10007992 [exp] 44 / 2e-06 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10006779 pacid=23163546 polypeptide=Lus10006779 locus=Lus10006779.g ID=Lus10006779.BGIv1.0 annot-version=v1.0 ATGAAGTGTGCCCACGACGTCGAGACGGTGCTGAAGGTGGCTACCACTGAAAAGAACAGAGAGCGTGCATTCTTTCGTTGCCCGTTCTGGAGGACTTCCG ACTGCGGGTTCTTCGTGTGGGAGTACAATTACAATAGATCTACAAGACAAGAACTGGTTTCAAGCAAAGGGTGGAGGAGACTTGAAGACCCAACCTCAAA TATCCAGTTTGAGTTACTTCTAGAGGAGATTAGGGGTGTTAGAAACAAAATCGAAGGCTTCGACAGTAGAATAACGCTTGTTCTTGGTAGTATTTGGGTG GTTGTATTGGCAGTGGCCATTTGCTGCACTGTTCGTTAA
AA sequence Show only first row Show all	>Lus10006779 pacid=23163546 polypeptide=Lus10006779 locus=Lus10006779.g ID=Lus10006779.BGIv1.0 annot-version=v1.0 MKCAHDVETVLKVATTEKNRERAFFRCPFWRTSDCGFFVWEYNYNRSTRQELVSSKGWRRLEDPTSNIQFELLLEEIRGVRNKIEGFDSRITLVLGSIWV VVLAVAICCTVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	0	1
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	2.6	0.9795
					Lus10033096 [exp]	3.7	0.9795
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	4.6	0.9795
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	5.3	0.9795
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	5.9	0.9721
AT3G44150			unknown protein		Lus10021005 [exp]	6.9	0.9625
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	7.5	0.9610
AT4G22410			Ubiquitin C-terminal hydrolase...		Lus10035548 [exp]	8.0	0.9576
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10004438 [exp]	8.5	0.9516
AT3G52490			Double Clp-N motif-containing ...		Lus10042638 [exp]	8.9	0.9451

Compare expression of checked genes

Lus10006779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.