Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G25275 54 / 3e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005808 [exp] 108 / 1e-31 AT3G17940 54 / 2e-10 Galactose mutarotase-like superfamily protein (.1) Lus10004192 [exp] 52 / 2e-10 AT1G25275 39 / 5e-05 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G116800 [exp] 68 / 4e-17 AT1G25275 53 / 5e-11 unknown protein Potri.015G114500 [exp] 62 / 1e-14 AT1G25275 59 / 2e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006792 pacid=23150776 polypeptide=Lus10006792 locus=Lus10006792.g ID=Lus10006792.BGIv1.0 annot-version=v1.0 ATGGAGAAATTGAGCAAATTGACGGTGGTGATGTTCTTAATAAGCCTCCTGGCGTTGAGTTGCAGTATTAACACGGTGGAGGCTGATGCATCCGATTGCT ATGATGGTTGTACTACCGCCTGCGTCCAGCCCAACACGAGACTGATGAGGAGGTGCGAGCTTAAATGCGGGATCAGATGCAATTCAGCTGCTGCTGCTTC TTCTTCTGCAGGTTAG
AA sequence Show only first row Show all	>Lus10006792 pacid=23150776 polypeptide=Lus10006792 locus=Lus10006792.g ID=Lus10006792.BGIv1.0 annot-version=v1.0 MEKLSKLTVVMFLISLLALSCSINTVEADASDCYDGCTTACVQPNTRLMRRCELKCGIRCNSAAAASSSAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G25275			unknown protein		Lus10006792 [exp]	0	1
AT2G41430		LSR1, CID1, ERD...	CTC-Interacting Domain 1, dehy...		Lus10018018 [exp]	2.0	0.8711
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	3.0	0.8981
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10001201 [exp]	5.0	0.8629
AT3G60540			Preprotein translocase Sec, Se...		Lus10010009 [exp]	6.3	0.8927
AT2G46080			unknown protein		Lus10036385 [exp]	7.1	0.8813
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	7.5	0.8366
AT1G70250			receptor serine/threonine kina...		Lus10025553 [exp]	8.8	0.8381
AT4G17250			unknown protein		Lus10008508 [exp]	10.0	0.8459
AT4G08230			glycine-rich protein (.1.2)		Lus10024100 [exp]	11.0	0.8473
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10036203 [exp]	12.0	0.8430

Compare expression of checked genes

Lus10006792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.