Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09890 65 / 2e-15 Protein of unknown function (DUF3511) (.1) AT3G05725 52 / 9e-10 Protein of unknown function (DUF3511) (.1) AT5G11970 51 / 9e-10 Protein of unknown function (DUF3511) (.1) AT2G47480 50 / 3e-09 Protein of unknown function (DUF3511) (.1) AT2G19460 49 / 9e-09 Protein of unknown function (DUF3511) (.1) AT1G72720 45 / 2e-07 Protein of unknown function (DUF3511) (.1) AT3G13910 44 / 4e-07 Protein of unknown function (DUF3511) (.1) AT3G62640 43 / 1e-06 Protein of unknown function (DUF3511) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005802 [exp] 142 / 6e-46 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10033529 [exp] 105 / 3e-31 AT4G09890 70 / 2e-17 Protein of unknown function (DUF3511) (.1) Lus10020842 [exp] 91 / 5e-25 AT4G09890 69 / 2e-16 Protein of unknown function (DUF3511) (.1) Lus10028690 [exp] 60 / 2e-13 AT4G09890 71 / 1e-17 Protein of unknown function (DUF3511) (.1) Lus10028734 [exp] 58 / 2e-12 AT4G09890 69 / 8e-17 Protein of unknown function (DUF3511) (.1) Lus10011939 [exp] 50 / 5e-09 AT2G19460 109 / 6e-32 Protein of unknown function (DUF3511) (.1) Lus10027629 [exp] 50 / 5e-09 AT2G19460 110 / 2e-32 Protein of unknown function (DUF3511) (.1) Lus10008471 [exp] 47 / 4e-08 AT2G19460 95 / 1e-26 Protein of unknown function (DUF3511) (.1) Lus10031405 [exp] 47 / 5e-08 AT3G05725 71 / 6e-17 Protein of unknown function (DUF3511) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G077500 [exp] 102 / 3e-30 AT4G09890 80 / 3e-21 Protein of unknown function (DUF3511) (.1) Potri.002G065200 [exp] 83 / 1e-22 AT4G09890 84 / 9e-23 Protein of unknown function (DUF3511) (.1) Potri.005G195800 [exp] 82 / 4e-22 AT4G09890 81 / 1e-21 Protein of unknown function (DUF3511) (.1) Potri.001G197700 [exp] 52 / 5e-10 AT2G19460 78 / 1e-19 Protein of unknown function (DUF3511) (.1) Potri.014G123600 [exp] 50 / 2e-09 AT2G47480 93 / 5e-26 Protein of unknown function (DUF3511) (.1) Potri.006G147700 [exp] 49 / 8e-09 AT2G19460 96 / 2e-26 Protein of unknown function (DUF3511) (.1) Potri.003G043600 [exp] 49 / 9e-09 AT5G11970 89 / 5e-24 Protein of unknown function (DUF3511) (.1) Potri.005G019900 [exp] 48 / 1e-08 AT3G05725 63 / 3e-14 Protein of unknown function (DUF3511) (.1) Potri.006G225900 [exp] 48 / 2e-08 AT5G11970 90 / 2e-24 Protein of unknown function (DUF3511) (.1) Potri.010G140800 [exp] 46 / 5e-08 AT2G47480 62 / 2e-14 Protein of unknown function (DUF3511) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12023 [flax] [poplar] DUF3511 Domain of unknown function (DUF3511)
Representative CDS sequence Show only first row Show all	>Lus10006799 pacid=23150762 polypeptide=Lus10006799 locus=Lus10006799.g ID=Lus10006799.BGIv1.0 annot-version=v1.0 ATGATGATGGAGAAGAGCAGATCGTTCTCGGGGTATTCGGAGATGAGGAGGATGGGGTTCGAGCATAAGTCGAATTCGTACAGCTTCAACGGGGGAGCTG CCGAGCTTGGGAGTGGTGGTAGTAGTGAGAATCCTGAGGTGAAAAGGAGGAAGAGAGTTGCTCAGTACAACGTCTACTCCAAAGAAGGTAAGCTCAAAAC CTCTCTTAGAAATAGCTTCAAGTGGATCAAGAGCAAGTTCATTGAAGACTACTTCCAAGACTGA
AA sequence Show only first row Show all	>Lus10006799 pacid=23150762 polypeptide=Lus10006799 locus=Lus10006799.g ID=Lus10006799.BGIv1.0 annot-version=v1.0 MMMEKSRSFSGYSEMRRMGFEHKSNSYSFNGGAAELGSGGSSENPEVKRRKRVAQYNVYSKEGKLKTSLRNSFKWIKSKFIEDYFQD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G09890			Protein of unknown function (D...		Lus10006799 [exp]	0	1
AT5G09430			alpha/beta-Hydrolases superfam...		Lus10033451 [exp]	1.4	0.9429
AT1G13245		RTFL17, DVL4	DEVIL 4, ROTUNDIFOLIA like 17 ...		Lus10041491 [exp]	2.4	0.9259
AT1G13580		LOH3, LAG13	LAG One Homologue 3, LAG1 long...		Lus10030571 [exp]	4.2	0.9361
AT4G12230			alpha/beta-Hydrolases superfam...		Lus10024569 [exp]	4.9	0.9206
AT1G04280			P-loop containing nucleoside t...		Lus10021226 [exp]	4.9	0.9003
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10019177 [exp]	7.3	0.8849
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Lus10018888 [exp]	8.5	0.9149
AT1G69870		NRT1.7	nitrate transporter 1.7 (.1)		Lus10037221 [exp]	9.2	0.8911
AT4G14305			Peroxisomal membrane 22 kDa (M...		Lus10011798 [exp]	11.4	0.8997
AT3G27020		YSL6	YELLOW STRIPE like 6 (.1)		Lus10041544 [exp]	11.6	0.9161

Compare expression of checked genes

Lus10006799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.