Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09960 117 / 2e-35 unknown protein AT5G64850 114 / 4e-34 unknown protein AT5G19473 60 / 6e-13 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G080800 [exp] 130 / 8e-41 AT5G09960 126 / 4e-39 unknown protein Potri.005G084700 [exp] 120 / 4e-37 AT5G09960 133 / 8e-42 unknown protein Potri.001G273300 [exp] 64 / 1e-14 AT5G19473 102 / 5e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.009G067600 [exp] 59 / 7e-13 AT5G19473 98 / 5e-28 RPM1-interacting protein 4 (RIN4) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [flax] [poplar] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Lus10006803 pacid=23150745 polypeptide=Lus10006803 locus=Lus10006803.g ID=Lus10006803.BGIv1.0 annot-version=v1.0 ATGTCGTCACAGAGGAACGCACCATGGCTATCAGTGCCACAATTCGGAGACTGGGATCAGAAGGGTCCATTGCCAGACTACTCCATGGATTTCTCCAAGA TCAGAGAAATGAGGAAGCAGAACAAAACAAGAGCAAGCCTTGGCAATGAAGAAGAATTCATCAACCCAACAGCAAACTTGCCCAAAGCCAGCACTCCTCC TACCCACCACCACCACAACAACAACGGCAACCGGGATCAACAACACTCTCCCAATACGAGGAGGAGCTTCTTCAGTTACTTCAACTGCTGTGTAAAAGCT TGA
AA sequence Show only first row Show all	>Lus10006803 pacid=23150745 polypeptide=Lus10006803 locus=Lus10006803.g ID=Lus10006803.BGIv1.0 annot-version=v1.0 MSSQRNAPWLSVPQFGDWDQKGPLPDYSMDFSKIREMRKQNKTRASLGNEEEFINPTANLPKASTPPTHHHHNNNGNRDQQHSPNTRRSFFSYFNCCVKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09960			unknown protein		Lus10006803 [exp]	0	1
AT1G72175			RING/U-box protein with domain...		Lus10020349 [exp]	1.0	0.9450
AT5G53050			alpha/beta-Hydrolases superfam...		Lus10022392 [exp]	6.5	0.9229
AT3G10260			Reticulon family protein (.1.2...		Lus10020718 [exp]	6.6	0.9035
AT2G39740		HESO1	HEN1 suppressor 1, Nucleotidyl...		Lus10030154 [exp]	7.7	0.9183
AT3G10260			Reticulon family protein (.1.2...		Lus10029822 [exp]	8.5	0.9204
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10040376 [exp]	8.9	0.9150
AT5G46410		SSP4	SCP1-like small phosphatase 4 ...		Lus10004596 [exp]	11.8	0.9105
AT3G62140			unknown protein		Lus10009976 [exp]	15.3	0.8955
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Lus10009376 [exp]	16.7	0.9214
AT1G04950		EMB2781, ATTAF6...	TBP-associated factor 6, EMBRY...		Lus10002443 [exp]	22.6	0.9105

Compare expression of checked genes

Lus10006803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.