Lus10006815 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20230 114 / 3e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G24000 111 / 2e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18750 108 / 3e-28 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49170 107 / 8e-28 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G11290 107 / 8e-28 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14850 107 / 1e-27 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G16835 106 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G37170 106 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 105 / 3e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22070 104 / 6e-27 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003382 296 / 2e-103 AT4G16835 212 / 2e-64 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004304 288 / 2e-101 AT1G11290 123 / 2e-32 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019213 277 / 6e-92 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10037063 105 / 4e-30 AT4G37170 124 / 3e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027365 105 / 8e-30 AT4G02750 133 / 3e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036921 112 / 2e-29 AT4G37170 806 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10015414 109 / 2e-28 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013991 109 / 2e-28 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010850 108 / 4e-28 AT5G60020 856 / 0.0 laccase 17 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G220300 119 / 5e-32 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G091600 118 / 9e-32 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G059400 118 / 1e-31 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 114 / 4e-30 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G001200 113 / 7e-30 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G119000 112 / 1e-29 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G322100 111 / 2e-29 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G077700 111 / 3e-29 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G027800 111 / 3e-29 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G105700 110 / 6e-29 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10006815 pacid=23150748 polypeptide=Lus10006815 locus=Lus10006815.g ID=Lus10006815.BGIv1.0 annot-version=v1.0
ATGGAGTTAGTCGAAAAAACTCCTGGTCTATCGGAGCATGCGGGGATATGGGGCGCTCTATTAGGTGCTTGTCGGATCCATCACAATGTGGGTCTTGCCA
TGAAGGCTGCGGAAACTCTATTCAAATTAGAACCCGGGAATCCTGGAAGATATGTCATGTTAGCGAATGTTTATACATCAGCTAATAAATGGAGTGATGC
TTCAAGAATGAGAAGGGAAGTGGATGAAAAAGGTCTAGTTAAAGATGTAGCTTACAGTTGGATTGAGGTGAGGAATGAGAGGCATGAGTTTGTGGCCAAG
GACAAGGCTCACAGACAGATACAAGAAGTATATGAAGCAATCCCTCGACTACTTGATCATATGAGGGAAGCTGGACACTGGCCTTCCACAAATGACTTTG
GATCGTCGGAGAAGATGATGTCCTAG
AA sequence
>Lus10006815 pacid=23150748 polypeptide=Lus10006815 locus=Lus10006815.g ID=Lus10006815.BGIv1.0 annot-version=v1.0
MELVEKTPGLSEHAGIWGALLGACRIHHNVGLAMKAAETLFKLEPGNPGRYVMLANVYTSANKWSDASRMRREVDEKGLVKDVAYSWIEVRNERHEFVAK
DKAHRQIQEVYEAIPRLLDHMREAGHWPSTNDFGSSEKMMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20230 Pentatricopeptide repeat (PPR)... Lus10006815 0 1
AT4G16835 Tetratricopeptide repeat (TPR)... Lus10003382 1.0 0.8830
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10004303 14.3 0.8258
AT1G74600 OTP87 organelle transcript processin... Lus10002054 19.0 0.8095
AT4G02400 U3 ribonucleoprotein (Utp) fam... Lus10007881 19.4 0.8057
AT5G61460 SMC6B, ATRAD18,... STRUCTURAL MAINTENANCE OF CHRO... Lus10038928 21.4 0.8257
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10000073 21.9 0.8016
Lus10019215 24.0 0.7825
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Lus10004304 24.1 0.7689
AT1G64790 ILA ILITYHIA (.1.2) Lus10003747 25.4 0.7813
AT4G13650 Pentatricopeptide repeat (PPR)... Lus10018978 27.3 0.8118

Lus10006815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.