Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53590 70 / 2e-16 SAUR-like auxin-responsive protein family (.1) AT4G00880 67 / 1e-15 SAUR-like auxin-responsive protein family (.1) AT2G46690 66 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT3G61900 64 / 4e-14 SAUR-like auxin-responsive protein family (.1) AT4G34800 62 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT5G20810 61 / 8e-13 SAUR-like auxin-responsive protein family (.1.2) AT2G21210 59 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT3G03820 59 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT4G34780 59 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT4G34790 59 / 2e-12 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005781 [exp] 199 / 4e-67 AT5G53590 70 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10010110 [exp] 67 / 3e-15 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 59 / 2e-12 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 59 / 2e-12 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 59 / 2e-12 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 59 / 4e-12 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 59 / 6e-12 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10003140 [exp] 59 / 6e-12 AT5G50760 97 / 8e-26 SAUR-like auxin-responsive protein family (.1) Lus10011332 [exp] 59 / 7e-12 AT5G50760 99 / 3e-26 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G002201 [exp] 120 / 1e-36 AT5G53590 74 / 8e-18 SAUR-like auxin-responsive protein family (.1) Potri.001G306300 [exp] 117 / 2e-35 AT5G53590 75 / 2e-18 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 70 / 1e-16 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 70 / 1e-16 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 70 / 2e-16 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 70 / 3e-16 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 64 / 3e-14 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 62 / 2e-13 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 62 / 2e-13 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 60 / 8e-13 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10006820 pacid=23150751 polypeptide=Lus10006820 locus=Lus10006820.g ID=Lus10006820.BGIv1.0 annot-version=v1.0 ATGCAAGAGAAGAACATGAAGATGAAGAAAGGTTGCATAGCTGTCCAAGTAGGGTTGGAGGAAGAAGATGATCAAGCAAGTAGGAGGAAGTTTGTGATCC CAATCTCATATCTTTACCACCCACTTTTCAAGTCTCTTCTTGACAAAGCCTATGAGGTGTTTGGCTACCATGTGGCAGGACCACTTAGGCTGCCTTGCTC CGTCGACGACTTCCTCCACCTTCGGTGGCAGATCGAGAGGGATTCCGACCACCACCACCACCGCGAGCTCCACCGTGGGAGATCAAGCTCCAACCATCAC CATCACCATCACCAGCATGTTCTTCAGACTGCCTTTTCTTTCAATTCTTGTTAG
AA sequence Show only first row Show all	>Lus10006820 pacid=23150751 polypeptide=Lus10006820 locus=Lus10006820.g ID=Lus10006820.BGIv1.0 annot-version=v1.0 MQEKNMKMKKGCIAVQVGLEEEDDQASRRKFVIPISYLYHPLFKSLLDKAYEVFGYHVAGPLRLPCSVDDFLHLRWQIERDSDHHHHRELHRGRSSSNHH HHHHQHVLQTAFSFNSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53590			SAUR-like auxin-responsive pro...		Lus10006820 [exp]	0	1
AT5G40960			Protein of unknown function (D...		Lus10012541 [exp]	1.0	0.7821
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10039024 [exp]	8.2	0.6564
AT1G44350		ILL6	IAA-leucine resistant (ILR)-li...		Lus10018169 [exp]	11.8	0.6966
					Lus10010661 [exp]	12.5	0.6251
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10014084 [exp]	25.8	0.6544
					Lus10005609 [exp]	35.1	0.6443
AT2G03210		ATFUT2, FUT2	fucosyltransferase 2 (.1)		Lus10026125 [exp]	38.0	0.6242
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Lus10021707 [exp]	38.3	0.6465
AT5G20480		EFR	EF-TU receptor (.1)		Lus10024681 [exp]	49.0	0.6421
					Lus10015031 [exp]	49.1	0.5552

Compare expression of checked genes

Lus10006820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.