Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17070 50 / 2e-08 GC-rich sequence DNA-binding factor-like protein with Tuftelin interacting domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000930 [exp] 62 / 1e-12 AT1G17070 895 / 0.0 GC-rich sequence DNA-binding factor-like protein with Tuftelin interacting domain (.1) Lus10002252 [exp] 50 / 1e-08 AT1G17070 622 / 0.0 GC-rich sequence DNA-binding factor-like protein with Tuftelin interacting domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G076000 [exp] 46 / 3e-07 AT1G17070 853 / 0.0 GC-rich sequence DNA-binding factor-like protein with Tuftelin interacting domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12457 [flax] [poplar] TIP_N Tuftelin interacting protein N terminal
Representative CDS sequence Show only first row Show all	>Lus10006831 pacid=23144397 polypeptide=Lus10006831 locus=Lus10006831.g ID=Lus10006831.BGIv1.0 annot-version=v1.0 ATGGACGAGAACCAGGAGTACGGCGTATTCCAGGCCAAATCCTCCGACTACCAAGGCGCGCGGCGGCGGCGGATGAAGCGGAGGAAATTTAAAAACCGCG ATCGCGATCTCACCAAGCCTGTCAACTTCGTCTCCACAGGTACTGTCATTCCTAACGACGAATTGGTTAAGAACTCTAGAGAATACAATAATAATAATAA TAACGATGTTGTTGTTGATGGTAGTAGCGGTAGGGCATATTTGGGGGCTGGCTCTGGATGA
AA sequence Show only first row Show all	>Lus10006831 pacid=23144397 polypeptide=Lus10006831 locus=Lus10006831.g ID=Lus10006831.BGIv1.0 annot-version=v1.0 MDENQEYGVFQAKSSDYQGARRRRMKRRKFKNRDRDLTKPVNFVSTGTVIPNDELVKNSREYNNNNNNDVVVDGSSGRAYLGAGSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17070			GC-rich sequence DNA-binding f...		Lus10006831 [exp]	0	1
AT4G04780		MED21	mediator 21 (.1)		Lus10008009 [exp]	36.6	0.6927
AT5G13010		EMB3011	embryo defective 3011, RNA hel...		Lus10009600 [exp]	72.0	0.6766
AT5G13640		PDAT1, ATPDAT	PHOSPHOLIPID:DIACYLGLYCEROL AC...		Lus10015639 [exp]	137.2	0.6390
AT5G14890			NHL domain-containing protein ...		Lus10001942 [exp]	173.8	0.6174

Compare expression of checked genes

Lus10006831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.