Lus10006833 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16190 295 / 4e-103 Isochorismatase family protein (.1)
AT5G23220 62 / 9e-12 NIC3 nicotinamidase 3 (.1)
AT5G23230 61 / 9e-12 NIC2 nicotinamidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037581 382 / 2e-137 AT3G16190 298 / 2e-104 Isochorismatase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G051700 324 / 1e-114 AT3G16190 269 / 6e-93 Isochorismatase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00857 Isochorismatase Isochorismatase family
Representative CDS sequence
>Lus10006833 pacid=23144403 polypeptide=Lus10006833 locus=Lus10006833.g ID=Lus10006833.BGIv1.0 annot-version=v1.0
ATGGCGGGGAAATGGAAGCAAACAGCTCTCTTAGTCATCGACATGCAGAATGATTTCATCTTGGATGGTTCGCCGGTGACAGTCGCCGGAGGGAAAGCTA
TTGTACCAAACGTGATCAAAGCCGTTGAAATCGCTCGGCAGCGTGGAATCCTCGTTGTTTGGGTGGTTCGAGAACACGATCTCCAAGGTAGAGACGTGGA
GGTTTTCCGTCGCCATTTGTACTCGTCGGGAGGGAATGCCGGCCCCACCACCAAAGGGAGTGTAGGTGCAGAGCTGGTTGATGGGCTTGTGATCAAAGAA
GGAGACTACAAGGTTGTGAAGACGAGGTTTAGTGCATTCTTCGCCACGCATCTTCATTCGTTTCTCAAGACCGAAGGGATTGAGAATCTGGTAGTTATCG
GAGTTCAGACTCCAAACTGTATCAGGCAGACTGTGTTTGATGCTGTAGCGCAGGATTACCTGTCGGTTTCGGTCATCTTGGATGCTACTGCAGCTGCAAC
CCCTGAGGTGCATCAAGCTAATATATTCGACATGAAGAATGTCGGAGTTGCGACTCCGACATTGCAGGAGTGGTCTGATGCTTGA
AA sequence
>Lus10006833 pacid=23144403 polypeptide=Lus10006833 locus=Lus10006833.g ID=Lus10006833.BGIv1.0 annot-version=v1.0
MAGKWKQTALLVIDMQNDFILDGSPVTVAGGKAIVPNVIKAVEIARQRGILVVWVVREHDLQGRDVEVFRRHLYSSGGNAGPTTKGSVGAELVDGLVIKE
GDYKVVKTRFSAFFATHLHSFLKTEGIENLVVIGVQTPNCIRQTVFDAVAQDYLSVSVILDATAAATPEVHQANIFDMKNVGVATPTLQEWSDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16190 Isochorismatase family protein... Lus10006833 0 1
AT5G24460 unknown protein Lus10032931 1.0 0.8716
AT4G09620 Mitochondrial transcription te... Lus10009420 3.0 0.8465
Lus10018325 3.2 0.8325
AT1G07710 Ankyrin repeat family protein ... Lus10024440 5.3 0.8569
AT4G23330 unknown protein Lus10032266 10.2 0.7959
AT5G10550 GTE2 global transcription factor gr... Lus10020471 10.9 0.8048
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Lus10002865 11.6 0.8263
AT1G29530 unknown protein Lus10015254 12.0 0.8032
Lus10039856 12.0 0.8139
AT5G16450 Ribonuclease E inhibitor RraA/... Lus10026835 12.2 0.7728

Lus10006833 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.