Lus10006837 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16175 114 / 5e-33 Thioesterase superfamily protein (.1)
AT2G29590 82 / 4e-20 Thioesterase superfamily protein (.1)
AT1G52191 74 / 3e-17 Thioesterase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037583 197 / 2e-65 AT3G16175 107 / 4e-30 Thioesterase superfamily protein (.1)
Lus10006834 195 / 9e-65 AT3G16175 102 / 4e-28 Thioesterase superfamily protein (.1)
Lus10037582 166 / 2e-52 AT3G16175 86 / 5e-21 Thioesterase superfamily protein (.1)
Lus10018205 87 / 6e-22 AT2G29590 206 / 6e-69 Thioesterase superfamily protein (.1)
Lus10040701 82 / 2e-20 AT2G29590 200 / 7e-67 Thioesterase superfamily protein (.1)
Lus10004288 65 / 2e-13 AT1G04290 226 / 5e-77 Thioesterase superfamily protein (.1)
Lus10019228 65 / 2e-13 AT1G04290 228 / 1e-77 Thioesterase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G051900 178 / 3e-58 AT3G16175 125 / 2e-37 Thioesterase superfamily protein (.1)
Potri.009G042100 72 / 2e-16 AT2G29590 177 / 8e-58 Thioesterase superfamily protein (.1)
Potri.004G134066 64 / 2e-13 AT1G04290 200 / 8e-67 Thioesterase superfamily protein (.1)
Potri.004G134132 59 / 3e-11 AT1G04290 166 / 2e-53 Thioesterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0050 HotDog PF03061 4HBT Thioesterase superfamily
Representative CDS sequence
>Lus10006837 pacid=23144426 polypeptide=Lus10006837 locus=Lus10006837.g ID=Lus10006837.BGIv1.0 annot-version=v1.0
ATGGGAAACGACGACGACGACGACAGTGTGGCGATCTCGAACAAATGGCTGCAAAATGTCGCCAGAGGATCAGATCAGCAGCAGCTCGTGCTGGAAAGCT
TAACCATGGCGGGAATCACCATCGTCGATTCTCGGAAAGGGTTCATCCGTTGCCGATTCACAGTCTCCGATCGAATCACCGACGGAGAAGGGAATTGGGA
AGTGGGAGCGATGGCGACGCTGATCGATGACGTGTCCGCGGCTGCAATCTACTCATTGGCCGGCCATGTCAAAGCTTCCGTCGATTTCAGCGTCTCTTTC
TTCTCCACTGCTAAATCTCTGGAAGAAATGGAGGTAGAGGCAAAGGTGATCGGAGAGAAAGAAAGGCTGGCGTCGGTGGTGATAGAGGTCAGAAGGAGAA
GCAACGGTGAGCTTATTGCTTTGGGGAAACAATGGATGGCTTCCCATAATAACACAACAACAACAACTAGTAAACTTTGA
AA sequence
>Lus10006837 pacid=23144426 polypeptide=Lus10006837 locus=Lus10006837.g ID=Lus10006837.BGIv1.0 annot-version=v1.0
MGNDDDDDSVAISNKWLQNVARGSDQQQLVLESLTMAGITIVDSRKGFIRCRFTVSDRITDGEGNWEVGAMATLIDDVSAAAIYSLAGHVKASVDFSVSF
FSTAKSLEEMEVEAKVIGEKERLASVVIEVRRRSNGELIALGKQWMASHNNTTTTTSKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16175 Thioesterase superfamily prote... Lus10006837 0 1
AT1G10940 ASK1, SNRK2-4, ... SNF1-related protein kinase 2.... Lus10019225 1.4 0.8770
AT1G02070 unknown protein Lus10009267 2.0 0.8907
AT2G46580 Pyridoxamine 5'-phosphate oxid... Lus10005977 3.5 0.8606
AT1G29690 CAD1 constitutively activated cell ... Lus10025235 4.6 0.8723
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10010188 4.9 0.8669
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Lus10019480 5.5 0.8638
AT3G19960 ATM1, ATATM myosin 1 (.1.2) Lus10010172 6.5 0.8386
AT4G16530 Family of unknown function (DU... Lus10000730 6.6 0.8513
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Lus10023428 8.0 0.8578
AT4G21470 ATFMN/FHY riboflavin kinase/FMN hydrolas... Lus10028605 8.7 0.8340

Lus10006837 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.